Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000835 [new locus tag: EGJ38_RS04170 ]
- pan locus tag?: SAUPAN006541000
- symbol: EGJ38_000835
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000835
- product: YopX family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000835 [new locus tag: EGJ38_RS04170 ]
- symbol: EGJ38_000835
- product: YopX family protein
- replicon: chromosome
- strand: +
- coordinates: 849519..849902
- length: 384
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422810 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATGCTGAAATTTAAAGCTTGGGATAAAGATAAAAAAGTTATGAGTATTATTGACGAA
ATCGATTTTAATAGTGGGTACATTTTGATTTCAACAGGTTATAAAAGTTTCGATGAAGTA
AAACTGCTACAATACACGGGTTTAAAAGATAAGAACAACACTGAAATATATGATGGCGAT
ATTGCAGAGTTTAAATATCCTCATGACAAACGTTTTAAAGAAATAGGGATAATAACGCAT
TCTGCAGAAAAGGCTTGTTTTGTAATCAAGATGATAAGAGACACAGTCCAAGAATTTGAG
TTATATAGAGGTGTTGCGAATAGCTATTTAAAAGTTATTGGTAATAAGTTTGATAATCCG
GAGTTACTGGAGGAATCGGAATGA60
120
180
240
300
360
384
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000835 [new locus tag: EGJ38_RS04170 ]
- symbol: EGJ38_000835
- description: YopX family protein
- length: 127
- theoretical pI: 5.02784
- theoretical MW: 14849.9
- GRAVY: -0.444882
⊟Function[edit | edit source]
- TIGRFAM: Hypothetical proteins Conserved phage conserved hypothetical protein TIGR01671 (TIGR01671; HMM-score: 54.6)Mobile and extrachromosomal element functions Prophage functions phage conserved hypothetical protein TIGR01671 (TIGR01671; HMM-score: 54.6)
- TheSEED:
- PFAM: no clan defined YopX; YopX protein (PF09643; HMM-score: 68)and 1 moreBrichos_S (CL0814) BRICHOS; BRICHOS domain (PF04089; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7358
- Cytoplasmic Membrane Score: 0.0751
- Cell wall & surface Score: 0.0016
- Extracellular Score: 0.1875
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004099
- TAT(Tat/SPI): 0.00019
- LIPO(Sec/SPII): 0.000726
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422810 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMLKFKAWDKDKKVMSIIDEIDFNSGYILISTGYKSFDEVKLLQYTGLKDKNNTEIYDGDIAEFKYPHDKRFKEIGIITHSAEKACFVIKMIRDTVQEFELYRGVANSYLKVIGNKFDNPELLEESE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000832 > EGJ38_000833 > EGJ38_000834 > EGJ38_000835 > EGJ38_000836 > EGJ38_000837 > EGJ38_000838 > EGJ38_000839 > EGJ38_000840 > EGJ38_000841 > EGJ38_000842 > rinB > EGJ38_000844 > EGJ38_000845
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)