From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000844 [new locus tag: EGJ38_RS04215 ]
  • pan locus tag?: SAUPAN002965000
  • symbol: EGJ38_000844
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_000844
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000844 [new locus tag: EGJ38_RS04215 ]
  • symbol: EGJ38_000844
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 852058..852204
  • length: 147
  • essential: unknown

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422819 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGATGTGGTTAGTCATAGCAATTATATTACTAGTCATCTTATTGTTTGGTGTGATGTTG
    CAAGCTGAACAGTTAAAAGGCGATGTGAAAGTTAAAGAGCGGGAGATAGAGATATTAAGA
    AGTAGATTGAGACATTTTGAAGATTAA
    60
    120
    147


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000844 [new locus tag: EGJ38_RS04215 ]
  • symbol: EGJ38_000844
  • description: hypothetical protein
  • length: 48
  • theoretical pI: 7.55167
  • theoretical MW: 5706.95
  • GRAVY: 0.629167

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein folding and stabilization cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 16.3)
    Metabolism Energy metabolism Electron transport cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 16.3)
    and 1 more
    heme exporter protein CcmD (TIGR03141; HMM-score: 12.7)
  • TheSEED:
  • PFAM:
    no clan defined DUF1514; Protein of unknown function (DUF1514) (PF07438; HMM-score: 8.2)
    Ibs_toxin; Toxin Ibs, type I toxin-antitoxin system (PF13956; HMM-score: 6.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0026
    • Cytoplasmic Membrane Score: 0.9629
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0344
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 22 aa
    • SP(Sec/SPI): 0.56121
    • TAT(Tat/SPI): 0.002563
    • LIPO(Sec/SPII): 0.111567
    • Cleavage Site: CS pos: 22-23. LQA-EQ. Pr: 0.4772
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422819 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MMWLVIAIILLVILLFGVMLQAEQLKGDVKVKEREIEILRSRLRHFED

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]