Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000837 [new locus tag: EGJ38_RS04180 ]
- pan locus tag?: SAUPAN002954000
- symbol: EGJ38_000837
- pan gene symbol?: higB
- synonym:
- alternate name: JSNZ_000837
- product: DUF1024 family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000837 [new locus tag: EGJ38_RS04180 ]
- symbol: EGJ38_000837
- product: DUF1024 family protein
- replicon: chromosome
- strand: +
- coordinates: 850323..850577
- length: 255
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422812 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATAACCGTGAACAAATAGAACAGTCCGTTATAAGTGCTAGTGCGTATAACGGCAAT
GACACAGAGGGATTACTAAAAGAGATTGAGGACGTGTATAAGAAAGCACAAGCGTTTGAT
GAAATACTTGAGGGTTTACCTAATGCTATGCAAGATGCACTCAAAGAAGATATTGAACTT
GATGAAGCAGTAGGGATTATGACGGGTCAAGTTGTCTATAAATATGAGGAGGAGCAGGAA
GATGAAAAAATTTAA60
120
180
240
255
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000837 [new locus tag: EGJ38_RS04180 ]
- symbol: EGJ38_000837
- description: DUF1024 family protein
- length: 84
- theoretical pI: 3.73996
- theoretical MW: 9528.41
- GRAVY: -0.709524
⊟Function[edit | edit source]
- TIGRFAM: hercynine metabolism small protein (TIGR04374; HMM-score: 13.9)
- TheSEED:
- PFAM: no clan defined DUF1024; Protein of unknown function (DUF1024) (PF06260; HMM-score: 161.5)and 1 moreTMP_2; Prophage tail length tape measure protein (PF06791; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.925
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0743
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010436
- TAT(Tat/SPI): 0.001506
- LIPO(Sec/SPII): 0.001085
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422812 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIELDEAVGIMTGQVVYKYEEEQEDEKI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000832 > EGJ38_000833 > EGJ38_000834 > EGJ38_000835 > EGJ38_000836 > EGJ38_000837 > EGJ38_000838 > EGJ38_000839 > EGJ38_000840 > EGJ38_000841 > EGJ38_000842 > rinB > EGJ38_000844 > EGJ38_000845
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)