Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000995 [new locus tag: EGJ38_RS04970 ]
- pan locus tag?: SAUPAN003224000
- symbol: EGJ38_000995
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000995
- product: YxeA family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000995 [new locus tag: EGJ38_RS04970 ]
- symbol: EGJ38_000995
- product: YxeA family protein
- replicon: chromosome
- strand: +
- coordinates: 1001034..1001354
- length: 321
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422964 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAATTTATCATTGCAATATTATTAGGATTAATATTATCCATTACTATTGCTTTTACA
ATCATACATCATCCTATACTTGATCGTTTTAATCCTTTCTTAAAAACGGAGTATAGTTAT
GCCAAAGTGCCAAAAGGTACGCAACAATATGTTAATATTACGGCTTATAGTGAAAGAGGG
GAAAAGCTTGATTATAAATTAACATTTAATGGATTTTCACCTAGTAGAACGTATGTCGAA
ATAAAGCATAAAGGGCAATATGTCATATCGATCACATATGTTGAAAAAGAGGATACACCA
AAAGAGGTAAGACAAGAATGA60
120
180
240
300
321
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000995 [new locus tag: EGJ38_RS04970 ]
- symbol: EGJ38_000995
- description: YxeA family protein
- length: 106
- theoretical pI: 9.5064
- theoretical MW: 12347.2
- GRAVY: -0.199057
⊟Function[edit | edit source]
- TIGRFAM: Hypothetical proteins Conserved conserved hypothetical protein (TIGR01655; HMM-score: 122.3)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined DUF1093; Protein of unknown function (DUF1093) (PF06486; HMM-score: 14)E-set (CL0159) Ig_NUP210_15th; NUP210 Ig-like domain 15 (PF22959; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.8571
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.1425
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.316143
- TAT(Tat/SPI): 0.000827
- LIPO(Sec/SPII): 0.041367
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422964 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFIIAILLGLILSITIAFTIIHHPILDRFNPFLKTEYSYAKVPKGTQQYVNITAYSERGEKLDYKLTFNGFSPSRTYVEIKHKGQYVISITYVEKEDTPKEVRQE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000992 > EGJ38_000993 > EGJ38_000994 > EGJ38_000995 > EGJ38_000996
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)