From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1039 [new locus tag: SACOL_RS05305 ]
  • pan locus tag?: SAUPAN003224000
  • symbol: SACOL1039
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1039 [new locus tag: SACOL_RS05305 ]
  • symbol: SACOL1039
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1048908..1049228
  • length: 321
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAATTTATCATTGCAATATTATTAGGATTAATATTATCCATTACTATTGCTTTTACA
    ATCATACATCATCCTATACTTGATCGTTTTAATCCTTTCTTAAAAACGGAGTATAGTTAT
    GCCAAAGTGCCAAAAGGTACGCAACAATATGTTAATATTACGGCTTATAGTGAAAGAGGG
    GAAAAGCTTGATTATAAATTAACATTTAATGGATTTTCACCTAGTAGAACGTATGTCGAA
    ATAAAGCATAAAGGGCAATATGTCATATCGATCACATATGTTGAAAAAGAGGATACACCA
    AAAGAGGTAAGACAAGAATGA
    60
    120
    180
    240
    300
    321

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1039 [new locus tag: SACOL_RS05305 ]
  • symbol: SACOL1039
  • description: hypothetical protein
  • length: 106
  • theoretical pI: 9.5064
  • theoretical MW: 12347.2
  • GRAVY: -0.199057

Function[edit | edit source]

  • TIGRFAM:
    Hypothetical proteins Conserved conserved hypothetical protein (TIGR01655; HMM-score: 122.3)
  • TheSEED  :
    • FIG01108238: hypothetical protein
  • PFAM:
    no clan defined DUF1093; Protein of unknown function (DUF1093) (PF06486; HMM-score: 14)
    E-set (CL0159) Ig_NUP210_15th; NUP210 Ig-like domain 15 (PF22959; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.8571
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.1425
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: PILDRFNP
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.316143
    • TAT(Tat/SPI): 0.000827
    • LIPO(Sec/SPII): 0.041367
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKFIIAILLGLILSITIAFTIIHHPILDRFNPFLKTEYSYAKVPKGTQQYVNITAYSERGEKLDYKLTFNGFSPSRTYVEIKHKGQYVISITYVEKEDTPKEVRQE

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Integral membrane [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]