Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001254 [new locus tag: EGJ38_RS06265 ]
- pan locus tag?: SAUPAN003584000
- symbol: rodZ
- pan gene symbol?: rodZ
- synonym:
- alternate name: JSNZ_001254
- product: helix-turn-helix domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001254 [new locus tag: EGJ38_RS06265 ]
- symbol: rodZ
- product: helix-turn-helix domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 1268272..1268664
- length: 393
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423219 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361TTGAAAACGGTCGGTGAAGCGCTAAAAGGTAGACGCGAAAGGTTAGGAATGACTTTAACA
GAATTAGAGCAACGTACTGGAATTAAACGTGAAATGCTAGTGCATATTGAAAATAATGAA
TTCGATCAACTACCGAATAAAAATTACAGCGAAGGATTTATTAGAAAATATGCAAGCGTA
GTAAATATTGAACCTAACCAATTAATTCAAGCTCATCAAGATGAAATTCCATCGAACCAA
GCCGAATGGGACGAAGTAATTACAGTTTTCAATAATAATAAAGACTTAGATTATAAGAGT
AAATCAAAAGAGCCAATACAATTATTAGTAATCATGGGTATTACAGTTTTAATAACTTTA
TTGTTATGGATCATGTTAGTTTTAATATTTTAA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001254 [new locus tag: EGJ38_RS06265 ]
- symbol: RodZ
- description: helix-turn-helix domain-containing protein
- length: 130
- theoretical pI: 5.24544
- theoretical MW: 15113.4
- GRAVY: -0.226154
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 16.1)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HTH (CL0123) HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 59.9)and 6 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 31.5)HTH_3; Helix-turn-helix (PF01381; HMM-score: 24.7)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 19.2)no clan defined COX5B; Cytochrome c oxidase subunit Vb (PF01215; HMM-score: 14.9)HTH (CL0123) Sulfolobus_pRN; Sulfolobus plasmid regulatory protein (PF05584; HMM-score: 13.5)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9938
- Cell wall & surface Score: 0
- Extracellular Score: 0.0061
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00614
- TAT(Tat/SPI): 0.000912
- LIPO(Sec/SPII): 0.002503
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423219 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLIQAHQDEIPSNQAEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITLLLWIMLVLIF
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_001253 > rodZ > pgsA
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)