Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1125 [new locus tag: SA_RS06360 ]
- pan locus tag?: SAUPAN003584000
- symbol: SA1125
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1125 [new locus tag: SA_RS06360 ]
- symbol: SA1125
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1278026..1278418
- length: 393
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123956 NCBI
- RefSeq: NP_374398 NCBI
- BioCyc:
- MicrobesOnline: 103424 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361TTGAAAACGGTCGGTGAAGCGCTAAAAGGTAGACGTGAAAGGTTAGGAATGACTTTAACA
GAATTAGAGCAACGTACTGGAATTAAACGTGAAATGCTAGTGCATATTGAAAATAATGAA
TTCGATCAACTACCGAATAAAAATTACAGCGAAGGATTTATTAGAAAATATGCAAGCGTA
GTAAATATTGAACCTAACCAATTAATTCAAGCTCATCAAGATGAAATTCCATCGAACCAA
GCCGAATGGGACGAAGTAATTACAGTTTTCAATAATAATAAAGACTTAGATTATAAGAGT
AAATCAAAAGAGCCAATACAATTATTAGTAATCATGGGTATTACAGTTTTAATAACTTTA
TTGTTATGGATCATGTTAGTTTTAATATTTTAA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1125 [new locus tag: SA_RS06360 ]
- symbol: SA1125
- description: hypothetical protein
- length: 130
- theoretical pI: 5.24544
- theoretical MW: 15113.4
- GRAVY: -0.226154
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 16.1)
- TheSEED: FIG01108279: hypothetical protein
- PFAM: HTH (CL0123) HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 60.3)and 7 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 37.1)HTH_3; Helix-turn-helix (PF01381; HMM-score: 25.1)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 24.1)Rubredoxin (CL0045) COX5B; Cytochrome c oxidase subunit Vb (PF01215; HMM-score: 14.9)no clan defined Tmemb_9; TMEM9 (PF05434; HMM-score: 13.6)HTH (CL0123) HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 13.6)Sulfolobus_pRN; Sulfolobus plasmid regulatory protein (PF05584; HMM-score: 13.5)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- LocateP: Intracellular /TMH start AFTER 60
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: Possibly Sec-
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00614
- TAT(Tat/SPI): 0.000912
- LIPO(Sec/SPII): 0.002503
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLIQAHQDEIPSNQAEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITLLLWIMLVLIF
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Ling Xu, Svetlana E Sedelnikova, Patrick J Baker, David W Rice
Cloning, purification and preliminary crystallographic analysis of a putative DNA-binding membrane protein, YmfM, from Staphylococcus aureus.
Acta Crystallogr Sect F Struct Biol Cryst Commun: 2008, 64(Pt 7);656-8
[PubMed:18607101] [WorldCat.org] [DOI] (I p)