From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1301 [new locus tag: SACOL_RS06640 ]
  • pan locus tag?: SAUPAN003584000
  • symbol: SACOL1301
  • pan gene symbol?: rodZ
  • synonym:
  • product: transcriptional regulator

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1301 [new locus tag: SACOL_RS06640 ]
  • symbol: SACOL1301
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 1317450..1317842
  • length: 393
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    TTGAAAACGGTCGGTGAAGCGCTAAAAGGTAGACGTGAAAGGTTAGGAATGACTTTAACA
    GAATTAGAGCAACGTACTGGAATTAAACGTGAAATGCTAGTGCATATTGAAAATAATGAA
    TTCGATCAACTACCGAATAAAAATTACAGCGAAGGATTTATTAGAAAATATGCAAGCGTA
    GTAAATATTGAACCTAACCAATTAATTCAAGCTCATCAAGATGAAATTCCATCGAACCAA
    GCCGAATGGGACGAAGTAATTACAGTTTTCAATAATAATAAAGACTTAGATTATAAGAGT
    AAATCAAAAGAGCCAATACAATTATTAGTAATCATGGGTATTACAGTTTTAATAACTTTA
    TTGTTATGGATCATGTTAGTTTTAATATTTTAA
    60
    120
    180
    240
    300
    360
    393


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1301 [new locus tag: SACOL_RS06640 ]
  • symbol: SACOL1301
  • description: transcriptional regulator
  • length: 130
  • theoretical pI: 5.24544
  • theoretical MW: 15113.4
  • GRAVY: -0.226154

⊟Function[edit | edit source]

  • TIGRFAM:
    Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 16.1)
  • TheSEED  :
    • Cytoskeleton protein RodZ
  • PFAM:
    HTH (CL0123) HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 59.9)
    and 6 more
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 31.5)
    HTH_3; Helix-turn-helix (PF01381; HMM-score: 24.7)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 19.2)
    no clan defined COX5B; Cytochrome c oxidase subunit Vb (PF01215; HMM-score: 14.9)
    HTH (CL0123) Sulfolobus_pRN; Sulfolobus plasmid regulatory protein (PF05584; HMM-score: 13.5)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 13)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9938
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0061
  • LocateP: Intracellular /TMH start AFTER 60
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: Possibly Sec-
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00614
    • TAT(Tat/SPI): 0.000912
    • LIPO(Sec/SPII): 0.002503
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLIQAHQDEIPSNQAEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITLLLWIMLVLIF

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Integral membrane [1] [2] [3]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]