Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001772 [new locus tag: EGJ38_RS08850 ]
- pan locus tag?: SAUPAN004482000
- symbol: crcB1
- pan gene symbol?: crcB1
- synonym:
- alternate name: JSNZ_001772
- product: fluoride efflux transporter CrcB
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001772 [new locus tag: EGJ38_RS08850 ]
- symbol: crcB1
- product: fluoride efflux transporter CrcB
- replicon: chromosome
- strand: +
- coordinates: 1824011..1824376
- length: 366
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423727 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCAATATGTATATATTTTTATCGGTGGTGCTTTAGGCGCTTTATTACGTTACCTCATT
TCTTTTCTGAATACTGACGGAGGTTTTCCAATCGGAACACTGATAGCCAATTTGACTGGT
GCCTTTGTAATGGGATTGCTAACAGCCTTAACAATTGCATTTTTTTCAAACCATCCGACC
CTAAAAAAAGCTATTACGACTGGTTTTCTTGGTGCTTTAACGACTTTTTCAACATTTCAA
TTAGAATTAATACATATGTTTGATCATCAACAATTTATAACTTTACTACTATATGCTGTA
ACAAGTTATGTCTTGGGTATTTTGTTATGTTACGTCGGTATAAAACTAGGTGGTGGTTTA
TCATGA60
120
180
240
300
360
366
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001772 [new locus tag: EGJ38_RS08850 ]
- symbol: CrcB1
- description: fluoride efflux transporter CrcB
- length: 121
- theoretical pI: 8.4518
- theoretical MW: 13061.5
- GRAVY: 1.00992
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General protein CrcB (TIGR00494; HMM-score: 86)
- TheSEED: data available for COL, N315, NCTC8325, Newman
- PFAM: DMT (CL0184) CRCB; CrcB-like protein, Camphor Resistance (CrcB) (PF02537; HMM-score: 102.3)and 4 moreno clan defined DUF6114; Family of unknown function (DUF6114) (PF19609; HMM-score: 12.5)Holin-III (CL0564) Phage_holin_3_3; LydA holin phage, holin superfamily III (PF16083; HMM-score: 12.1)no clan defined DUF5676; 2TM family of unknown function (DUF5676) (PF18926; HMM-score: 11.4)DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 5.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.001
- Cytoplasmic Membrane Score: 0.9984
- Cell wall & surface Score: 0
- Extracellular Score: 0.0005
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.015512
- TAT(Tat/SPI): 0.000294
- LIPO(Sec/SPII): 0.004469
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423727 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLLTALTIAFFSNHPTLKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAVTSYVLGILLCYVGIKLGGGLS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)