Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01903
- pan locus tag?: SAUPAN004482000
- symbol: SAOUHSC_01903
- pan gene symbol?: crcB1
- synonym: crcB
- product: camphor resistance protein CrcB
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01903
- symbol: SAOUHSC_01903
- product: camphor resistance protein CrcB
- replicon: chromosome
- strand: +
- coordinates: 1812693..1813058
- length: 366
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3920850 NCBI
- RefSeq: YP_500404 NCBI
- BioCyc: G1I0R-1769 BioCyc
- MicrobesOnline: 1290318 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCAATATGTATATATTTTTATCGGTGGTGCTTTAGGCGCTTTATTACGTTACCTCATT
TCTTTTCTGAATACTGACGGAGGTTTTCCAATCGGAACACTGATAGCCAATTTGACTGGT
GCCTTTGTAATGGGATTGCTAACAGCCTTAACAATTGCATTTTTTTCAAACCATCCGACC
CTAAAAAAAGCTATTACGACTGGTTTTCTTGGTGCTTTAACGACTTTTTCAACATTTCAA
TTAGAATTAATACATATGTTTGATCATCAACAATTTATAACTTTACTACTATATGCTGTA
ACAAGTTATGTCTTTGGTATTTTGTTATGTTACGTCGGTATAAAACTAGGTGGTGGTTTA
TCATGA60
120
180
240
300
360
366
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01903
- symbol: SAOUHSC_01903
- description: camphor resistance protein CrcB
- length: 121
- theoretical pI: 8.4518
- theoretical MW: 13095.5
- GRAVY: 1.00165
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General protein CrcB (TIGR00494; HMM-score: 85)
- TheSEED :
- Fluoride ion exporter CrcB/FEX
- PFAM: DMT (CL0184) CRCB; CrcB-like protein, Camphor Resistance (CrcB) (PF02537; HMM-score: 101.3)and 4 moreno clan defined DUF6114; Family of unknown function (DUF6114) (PF19609; HMM-score: 12.3)DUF5676; 2TM family of unknown function (DUF5676) (PF18926; HMM-score: 11.5)Holin-III (CL0564) Phage_holin_3_3; LydA holin phage, holin superfamily III (PF16083; HMM-score: 10.4)no clan defined DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 5.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0007
- Cytoplasmic Membrane Score: 0.999
- Cell wall & surface Score: 0
- Extracellular Score: 0.0004
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.015512
- TAT(Tat/SPI): 0.000294
- LIPO(Sec/SPII): 0.004469
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLLTALTIAFFSNHPTLKKAITTGFLGALTTFSTFQLELIHMFDHQQFITLLLYAVTSYVFGILLCYVGIKLGGGLS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [1]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
