From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001973 [new locus tag: EGJ38_RS09850 ]
  • pan locus tag?: SAUPAN005008000
  • symbol: map_2
  • pan gene symbol?: map_2
  • synonym:
  • alternate name: JSNZ_001973
  • product: MAP domain-containing protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001973 [new locus tag: EGJ38_RS09850 ]
  • symbol: map_2
  • product: MAP domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1984877..1985167
  • length: 291
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423881 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    GTGAAATTCCCAGTAACAATAAATAAATTTGAAAACATAGTTTCAAATGAATTTGTGTTC
    TATAATGCAAGCAAAATTACAATTAATGATTTAAGTATAAAACTTAAATCAGCAATTGCA
    AATGATCAAGGGATAACTAAACATGACATAGAACTTGCTGAACGCGCAGTGTATAAAGTG
    TATTTTAAAAATGGTTCGTCAAAATATGTAGACTTAAAAACTGAGTATAAAGATGAAAGA
    GTATTTAAAGCAACTGACATTAAAAAGGTAGATATTGAACTTAAATTCTAA
    60
    120
    180
    240
    291


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001973 [new locus tag: EGJ38_RS09850 ]
  • symbol: Map_2
  • description: MAP domain-containing protein
  • length: 96
  • theoretical pI: 9.59944
  • theoretical MW: 11159.8
  • GRAVY: -0.364583

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for N315, NCTC8325
  • PFAM:
    no clan defined MAP; MAP domain (PF03642; HMM-score: 118)
    and 2 more
    Ubiquitin (CL0072) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 17.1)
    SLBB_2; SLBB domain (PF22461; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.3322
    • Cytoplasmic Membrane Score: 0.0132
    • Cell wall & surface Score: 0.001
    • Extracellular Score: 0.6536
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.017177
    • TAT(Tat/SPI): 0.000244
    • LIPO(Sec/SPII): 0.00052
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423881 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKFPVTINKFENIVSNEFVFYNASKITINDLSIKLKSAIANDQGITKHDIELAERAVYKVYFKNGSSKYVDLKTEYKDERVFKATDIKKVDIELKF

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SaeR (activation) regulon
    SaeR(TF)important in Virulence;  regulation predicted or transferred from N315 and NCTC 8325  [2]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]