Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02160
- pan locus tag?: SAUPAN005008000
- symbol: SAOUHSC_02160
- pan gene symbol?: map_2
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02160
- symbol: SAOUHSC_02160
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2029297..2029587
- length: 291
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921856 NCBI
- RefSeq: YP_500649 NCBI
- BioCyc: G1I0R-2045 BioCyc
- MicrobesOnline: 1290605 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGAAATTCCCAGTAACAATAAATAAATTTGAAAACATAGTTTCAAATGAATTTGTGTTC
TATAATGCAAGCAAAATTACAATTAATGATTTAAGTATAAAACTTAAATCAGCAATGGCA
AATGATCAAGGGATAACTAAACATGACATAGGACTTGCTGAACGCGCAGTGTATAAAGTG
TATTTTAAAAATGGTTCGTCAAAATATGTAGACTTAAAAACTGAGTATAAAGATGAAAGA
GTATTTAAAGCAACTGACATTAAAAAGGTAGATATTGAACTTAAATTCTAA60
120
180
240
291
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02160
- symbol: SAOUHSC_02160
- description: hypothetical protein
- length: 96
- theoretical pI: 9.8041
- theoretical MW: 11105.8
- GRAVY: -0.359375
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Extracellular adherence protein of broad specificity Eap/Map
- PFAM: no clan defined MAP; MAP domain (PF03642; HMM-score: 120.1)and 1 moreUbiquitin (CL0072) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 18.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.2954
- Cytoplasmic Membrane Score: 0.0132
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.6907
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.043702
- TAT(Tat/SPI): 0.000505
- LIPO(Sec/SPII): 0.000615
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFPVTINKFENIVSNEFVFYNASKITINDLSIKLKSAMANDQGITKHDIGLAERAVYKVYFKNGSSKYVDLKTEYKDERVFKATDIKKVDIELKF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- predicted SigA promoter [1] : SAOUHSC_02160 < SAOUHSC_02161
⊟Regulation[edit | edit source]
- regulator: SaeR* (activation) regulon
SaeR* (TF) important in Virulence; transcription unit transferred from N315 data RegPrecise [1]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [1]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
