Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS09850 [old locus tag: EGJ38_001973 ]
- pan locus tag?: SAUPAN005008000
- symbol: EGJ38_RS09850
- pan gene symbol?: map_2
- synonym:
- product: MAP domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS09850 [old locus tag: EGJ38_001973 ]
- symbol: EGJ38_RS09850
- product: MAP domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1984877..1985167
- length: 291
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (1984877..1985167) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGAAATTCCCAGTAACAATAAATAAATTTGAAAACATAGTTTCAAATGAATTTGTGTTC
TATAATGCAAGCAAAATTACAATTAATGATTTAAGTATAAAACTTAAATCAGCAATTGCA
AATGATCAAGGGATAACTAAACATGACATAGAACTTGCTGAACGCGCAGTGTATAAAGTG
TATTTTAAAAATGGTTCGTCAAAATATGTAGACTTAAAAACTGAGTATAAAGATGAAAGA
GTATTTAAAGCAACTGACATTAAAAAGGTAGATATTGAACTTAAATTCTAA60
120
180
240
291
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS09850 [old locus tag: EGJ38_001973 ]
- symbol: EGJ38_RS09850
- description: MAP domain-containing protein
- length: 96
- theoretical pI: 9.59944
- theoretical MW: 11159.8
- GRAVY: -0.364583
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.3322
- Cytoplasmic Membrane Score: 0.0132
- Cell wall & surface Score: 0.001
- Extracellular Score: 0.6536
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017177
- TAT(Tat/SPI): 0.000244
- LIPO(Sec/SPII): 0.00052
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001792929 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKFPVTINKFENIVSNEFVFYNASKITINDLSIKLKSAIANDQGITKHDIELAERAVYKVYFKNGSSKYVDLKTEYKDERVFKATDIKKVDIELKF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SaeR see EGJ38_001973
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]