From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS09850 [old locus tag: EGJ38_001973 ]
  • pan locus tag?: SAUPAN005008000
  • symbol: EGJ38_RS09850
  • pan gene symbol?: map_2
  • synonym:
  • product: MAP domain-containing protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS09850 [old locus tag: EGJ38_001973 ]
  • symbol: EGJ38_RS09850
  • product: MAP domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1984877..1985167
  • length: 291
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1984877..1985167) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    GTGAAATTCCCAGTAACAATAAATAAATTTGAAAACATAGTTTCAAATGAATTTGTGTTC
    TATAATGCAAGCAAAATTACAATTAATGATTTAAGTATAAAACTTAAATCAGCAATTGCA
    AATGATCAAGGGATAACTAAACATGACATAGAACTTGCTGAACGCGCAGTGTATAAAGTG
    TATTTTAAAAATGGTTCGTCAAAATATGTAGACTTAAAAACTGAGTATAAAGATGAAAGA
    GTATTTAAAGCAACTGACATTAAAAAGGTAGATATTGAACTTAAATTCTAA
    60
    120
    180
    240
    291


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS09850 [old locus tag: EGJ38_001973 ]
  • symbol: EGJ38_RS09850
  • description: MAP domain-containing protein
  • length: 96
  • theoretical pI: 9.59944
  • theoretical MW: 11159.8
  • GRAVY: -0.364583

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for N315, NCTC8325
  • PFAM:
    no clan defined MAP; MAP domain (PF03642; HMM-score: 118)
    and 2 more
    Ubiquitin (CL0072) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 17.1)
    SLBB_2; SLBB domain (PF22461; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.3322
    • Cytoplasmic Membrane Score: 0.0132
    • Cell wall & surface Score: 0.001
    • Extracellular Score: 0.6536
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.017177
    • TAT(Tat/SPI): 0.000244
    • LIPO(Sec/SPII): 0.00052
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001792929 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKFPVTINKFENIVSNEFVFYNASKITINDLSIKLKSAIANDQGITKHDIELAERAVYKVYFKNGSSKYVDLKTEYKDERVFKATDIKKVDIELKF

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]