Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002101 [new locus tag: EGJ38_RS10490 ]
- pan locus tag?: SAUPAN005437000
- symbol: EGJ38_002101
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_002101
- product: thiol-disulfide oxidoreductase DCC family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002101 [new locus tag: EGJ38_RS10490 ]
- symbol: EGJ38_002101
- product: thiol-disulfide oxidoreductase DCC family protein
- replicon: chromosome
- strand: -
- coordinates: 2112878..2113291
- length: 414
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424002 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCCAATCGTATATTATGATGGAAACTGTATATATTGTTATAACTATGTCATTTGGTTA
ATTCAACATGACCTACCAAGAAATTATCAATTTGCCACGTTAAAAGGTGAAGTTGGACAA
CAATTTTTTAAACAACATCCAGAAGCGGCAAATAAAAATAGTGTGATTTTACAGAAAGGT
GATCGTATATATTTTGAATCGCAGGCGATTATTAAACTAATCACAGCACTACCTAATCGA
ACTAAATTATTGGGCGTAGGTTTATGGCTTGTACCTAAACCAGTCCGTAATTTCGGTTAT
CGAATGTTTGCTAATAATAGAAATAGAATGTGGAAAACAACATGGCACCAACCAAATGAT
TATGAAAAATCGTTCTTTTTAGATGATAATGCGAAAGTAAAACTTACTGATTGA60
120
180
240
300
360
414
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002101 [new locus tag: EGJ38_RS10490 ]
- symbol: EGJ38_002101
- description: thiol-disulfide oxidoreductase DCC family protein
- length: 137
- theoretical pI: 9.81923
- theoretical MW: 16253.6
- GRAVY: -0.459854
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined DCC1-like; DCC1-like thiol-disulfide oxidoreductase (PF04134; HMM-score: 79.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0588
- Cytoplasmic Membrane Score: 0.9267
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0143
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005967
- TAT(Tat/SPI): 0.000154
- LIPO(Sec/SPII): 0.000961
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424002 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MPIVYYDGNCIYCYNYVIWLIQHDLPRNYQFATLKGEVGQQFFKQHPEAANKNSVILQKGDRIYFESQAIIKLITALPNRTKLLGVGLWLVPKPVRNFGYRMFANNRNRMWKTTWHQPNDYEKSFFLDDNAKVKLTD
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)