Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002378 [new locus tag: EGJ38_RS11870 ]
- pan locus tag?: SAUPAN005940000
- symbol: EGJ38_002378
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_002378
- product: type II toxin-antitoxin system Phd/YefM family antitoxin
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002378 [new locus tag: EGJ38_RS11870 ]
- symbol: EGJ38_002378
- product: type II toxin-antitoxin system Phd/YefM family antitoxin
- replicon: chromosome
- strand: -
- coordinates: 2377514..2377765
- length: 252
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424261 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGATTATTAAAAATTATTCATACGCTCGACAGAATTTAAAGGCACTTATGACAAAAGTA
AATGATGATAGTGATATGGTAACTGTAACATCTACTGATGATAAAAACGTAGTAATCATG
TCAGAATCAGATTATAACTCCATGATGGAAACACTTTACCTCCAACAGAACCCAAATAAT
GCTGAACACTTAGCTCAATCAATTGCAGATCTAGAACGTGGGAAAACTATAACGAAAGAT
ATAGATGTATAA60
120
180
240
252
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002378 [new locus tag: EGJ38_RS11870 ]
- symbol: EGJ38_002378
- description: type II toxin-antitoxin system Phd/YefM family antitoxin
- length: 83
- theoretical pI: 4.3408
- theoretical MW: 9433.56
- GRAVY: -0.546988
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance prevent-host-death family protein (TIGR01552; HMM-score: 27.1)Mobile and extrachromosomal element functions Other prevent-host-death family protein (TIGR01552; HMM-score: 27.1)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: YefM-like (CL0871) PhdYeFM_antitox; Antitoxin Phd_YefM, type II toxin-antitoxin system (PF02604; HMM-score: 82.9)and 2 moreno clan defined DUF4860; Domain of unknown function (DUF4860) (PF16152; HMM-score: 13.9)DUF3841; Domain of unknown function (DUF3841) (PF12952; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9766
- Cytoplasmic Membrane Score: 0.0013
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0218
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005814
- TAT(Tat/SPI): 0.000251
- LIPO(Sec/SPII): 0.000898
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424261 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNNAEHLAQSIADLERGKTITKDIDV
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_002376 < EGJ38_002377 < EGJ38_002378
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)