From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS11870 [old locus tag: EGJ38_002378 ]
  • pan locus tag?: SAUPAN005940000
  • symbol: EGJ38_RS11870
  • pan gene symbol?:
  • synonym:
  • product: type II toxin-antitoxin system Phd/YefM family antitoxin

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS11870 [old locus tag: EGJ38_002378 ]
  • symbol: EGJ38_RS11870
  • product: type II toxin-antitoxin system Phd/YefM family antitoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 2377514..2377765
  • length: 252
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (2377514..2377765) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGATTATTAAAAATTATTCATACGCTCGACAGAATTTAAAGGCACTTATGACAAAAGTA
    AATGATGATAGTGATATGGTAACTGTAACATCTACTGATGATAAAAACGTAGTAATCATG
    TCAGAATCAGATTATAACTCCATGATGGAAACACTTTACCTCCAACAGAACCCAAATAAT
    GCTGAACACTTAGCTCAATCAATTGCAGATCTAGAACGTGGGAAAACTATAACGAAAGAT
    ATAGATGTATAA
    60
    120
    180
    240
    252


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS11870 [old locus tag: EGJ38_002378 ]
  • symbol: EGJ38_RS11870
  • description: type II toxin-antitoxin system Phd/YefM family antitoxin
  • length: 83
  • theoretical pI: 4.3408
  • theoretical MW: 9433.56
  • GRAVY: -0.546988

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance prevent-host-death family protein (TIGR01552; HMM-score: 27.1)
    Genetic information processing Mobile and extrachromosomal element functions Other prevent-host-death family protein (TIGR01552; HMM-score: 27.1)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    YefM-like (CL0871) PhdYeFM_antitox; Antitoxin Phd_YefM, type II toxin-antitoxin system (PF02604; HMM-score: 82.9)
    and 2 more
    no clan defined DUF4860; Domain of unknown function (DUF4860) (PF16152; HMM-score: 13.9)
    DUF3841; Domain of unknown function (DUF3841) (PF12952; HMM-score: 13)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9766
    • Cytoplasmic Membrane Score: 0.0013
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0218
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005814
    • TAT(Tat/SPI): 0.000251
    • LIPO(Sec/SPII): 0.000898
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000584499 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNNAEHLAQSIADLERGKTITKDIDV

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]