Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002469 [new locus tag: EGJ38_RS12320 ]
- pan locus tag?: SAUPAN006089000
- symbol: EGJ38_002469
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_002469
- product: (deoxy)nucleoside triphosphate pyrophosphohydrolase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002469 [new locus tag: EGJ38_RS12320 ]
- symbol: EGJ38_002469
- product: (deoxy)nucleoside triphosphate pyrophosphohydrolase
- replicon: chromosome
- strand: -
- coordinates: 2466950..2467342
- length: 393
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424348 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAAAAGTAATCAATGTAGTAGGAGCTATTATTTTTTCTGATAACAAAATTCTTTGT
GCACAGAGAAGTGAAAAAATGAGTCTGCCTTTAATGTGGGAATTTCCTGGCGGTAAGGTT
GAAAAGAATGAAACTGAAAAAGACGCTTTGATTAGAGAAATTAGAGAAGAAATGAAATGT
GATTTAATTGTTGGAGACAAAGTTATAACTACAGAACATGAATATGATTTTGGAATTGTT
AGGTTAACAACATACAAATGTACTTTAAACAAAGAGTTACCAACTCTAACTGAACATAAG
AGTATTGAATGGTTGTCAATAAACGAACTTGATAAATTAAATTGGGCCCCAGCGGATATA
CCAGCCGTTAATAAAATTATGACTGAGGGATAA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002469 [new locus tag: EGJ38_RS12320 ]
- symbol: EGJ38_002469
- description: (deoxy)nucleoside triphosphate pyrophosphohydrolase
- length: 130
- theoretical pI: 5.03646
- theoretical MW: 14894.3
- GRAVY: -0.277692
⊟Function[edit | edit source]
- reaction: EC 3.6.-.-? ExPASy
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair mutator mutT protein (TIGR00586; EC 3.6.1.-; HMM-score: 74.6)and 1 moreDNA metabolism DNA replication, recombination, and repair nucleoside triphosphatase YtkD (TIGR02705; EC 3.6.1.-; HMM-score: 30.3)
- TheSEED: data available for N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: NUDIX (CL0261) NUDIX_4; NUDIX domain (PF14815; HMM-score: 62.8)NUDIX; NUDIX domain (PF00293; HMM-score: 57.8)and 2 moreNudt16-like; U8 snoRNA-decapping enzyme-like (PF22327; HMM-score: 16.5)GST_C (CL0497) GST_C; Glutathione S-transferase, C-terminal domain (PF00043; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9938
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0
- Extracellular Score: 0.006
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.054851
- TAT(Tat/SPI): 0.000904
- LIPO(Sec/SPII): 0.028085
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424348 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKVINVVGAIIFSDNKILCAQRSEKMSLPLMWEFPGGKVEKNETEKDALIREIREEMKCDLIVGDKVITTEHEYDFGIVRLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADIPAVNKIMTEG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_002468 < EGJ38_002469
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)