Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2432 [new locus tag: SAUSA300_RS13470 ]
- pan locus tag?: SAUPAN006089000
- symbol: SAUSA300_2432
- pan gene symbol?: —
- synonym:
- product: MutT/NUDIX family hydrolase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2432 [new locus tag: SAUSA300_RS13470 ]
- symbol: SAUSA300_2432
- product: MutT/NUDIX family hydrolase
- replicon: chromosome
- strand: -
- coordinates: 2617686..2618078
- length: 393
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913225 NCBI
- RefSeq: YP_495066 NCBI
- BioCyc: GH3C-2418 BioCyc
- MicrobesOnline: 1293947 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAAAAGTAATCAATGTAGTAGGAGCTATTATTTTTTCTGATAACAAAATTCTTTGT
GCACAGAGAAGTGAAAAAATGAGTCTGCCTTTAATGTGGGAATTTCCTGGCGGTAAGGTT
GAAAAGAATGAAACTGAAAAAGACGCTTTGATTAGAGAAATTAGAGAAGAAATGAAATGT
GATTTAATTGTTGGAGACAAAGTTATAACTACAGAACATGAATATGATTTTGGAATTGTT
AGGTTAACAACATACAAATGTACTTTAAACAAAGAGTTACCAACTCTAACTGAACATAAG
AGTATTGAATGGTTGTCAATAAACGAACTTGATAAATTAAATTGGGCCCCAGCGGATATA
CCAGCCGTTAATAAAATTATGACTGAGGGATAA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2432 [new locus tag: SAUSA300_RS13470 ]
- symbol: SAUSA300_2432
- description: MutT/NUDIX family hydrolase
- length: 130
- theoretical pI: 5.03646
- theoretical MW: 14894.3
- GRAVY: -0.277692
⊟Function[edit | edit source]
- reaction: EC 3.6.1.-? ExPASy
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair mutator mutT protein (TIGR00586; EC 3.6.1.-; HMM-score: 74.6)and 1 moreDNA metabolism DNA replication, recombination, and repair nucleoside triphosphatase YtkD (TIGR02705; EC 3.6.1.-; HMM-score: 30.3)
- TheSEED :
- Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)
- PFAM: NUDIX (CL0261) NUDIX; NUDIX domain (PF00293; HMM-score: 55.2)and 2 moreNUDIX_4; NUDIX domain (PF14815; HMM-score: 42.9)E-set (CL0159) PKD_3; PKD-like domain (PF16820; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.054851
- TAT(Tat/SPI): 0.000904
- LIPO(Sec/SPII): 0.028085
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKVINVVGAIIFSDNKILCAQRSEKMSLPLMWEFPGGKVEKNETEKDALIREIREEMKCDLIVGDKVITTEHEYDFGIVRLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADIPAVNKIMTEG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]