Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2278 [new locus tag: SA_RS13070 ]
- pan locus tag?: SAUPAN006089000
- symbol: SA2278
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2278 [new locus tag: SA_RS13070 ]
- symbol: SA2278
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2554471..2554863
- length: 393
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1125206 NCBI
- RefSeq: NP_375602 NCBI
- BioCyc: see SA_RS13070
- MicrobesOnline: 104628 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAAAAGTAATCAATGTAGTAGGAGCTATTATTTTTTCTGATAACAAAATTCTTTGT
GCACAGAGAAGTGAAGAAATGAGTCTACCTTTAATGTGGGAATTTCCTGGCGGTAAGATT
GAAAAGAATGAAACTGAAAAAGAAGCTTTGATTAGAGAAATTAGAGAAGAAATGAAATGT
GATCTAATTGTTGGAGACAAAGTCATAACTACAGAACATGAATATGATTTTGGCATTGTT
AAGTTAACAACATACAAATGTACTTTAAACAAAGAGTTACCAACTTTAACTGAACATAAG
AGTATTGAATGGTTGTCAATAAACGAACTTGATAAATTAAATTGGGCCCCAGCGGATATA
CCAGCCGTTAATAAAATTATGACTGAGGGATAA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2278 [new locus tag: SA_RS13070 ]
- symbol: SA2278
- description: hypothetical protein
- length: 130
- theoretical pI: 4.73465
- theoretical MW: 14895.2
- GRAVY: -0.267692
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair mutator mutT protein (TIGR00586; EC 3.6.1.-; HMM-score: 76.8)and 1 moreDNA metabolism DNA replication, recombination, and repair nucleoside triphosphatase YtkD (TIGR02705; EC 3.6.1.-; HMM-score: 28.6)
- TheSEED :
- Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)
- PFAM: NUDIX (CL0261) NUDIX_4; NUDIX domain (PF14815; HMM-score: 61.1)NUDIX; NUDIX domain (PF00293; HMM-score: 56)and 3 moreNudt16-like; U8 snoRNA-decapping enzyme-like (PF22327; HMM-score: 15.7)E-set (CL0159) PKD_3; PKD-like domain (PF16820; HMM-score: 13.1)NUDIX (CL0261) NUDIX_2; Nucleotide hydrolase (PF13869; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9955
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0
- Extracellular Score: 0.0043
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.055445
- TAT(Tat/SPI): 0.000797
- LIPO(Sec/SPII): 0.028124
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKVINVVGAIIFSDNKILCAQRSEEMSLPLMWEFPGGKIEKNETEKEALIREIREEMKCDLIVGDKVITTEHEYDFGIVKLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADIPAVNKIMTEG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA2276 < SA2277 < SA2278
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]