Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002568 [new locus tag: EGJ38_RS12820 ]
- pan locus tag?: SAUPAN006266000
- symbol: EGJ38_002568
- pan gene symbol?: lapT1
- synonym:
- alternate name: JSNZ_002568
- product: TIGR04197 family type VII secretion effector
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002568 [new locus tag: EGJ38_RS12820 ]
- symbol: EGJ38_002568
- product: TIGR04197 family type VII secretion effector
- replicon: chromosome
- strand: -
- coordinates: 2574776..2575054
- length: 279
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424447 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGATGAGTACAGTTCAAAGTGATATTTTCAAGACTAATAGTGCATCATCATCTATTAAA
AGCGCTGTTGAAACATGTAATAATGTGTCGAAACCGGATAAAGATGAAAGTACAACAGTA
AGTGGAAATAATAATGCTCATAGTGTGATAGATGATTTGATGAGTAAGAATCAATCTGTT
GCTGAAGCAATACGAACTGCGAGCGATAATATACAAAAAGTTGGTGAGGCTTTTGACCAA
ACTGACGTAATGATTGGTAATGAAATTGGTAAAAATTAA60
120
180
240
279
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002568 [new locus tag: EGJ38_RS12820 ]
- symbol: EGJ38_002568
- description: TIGR04197 family type VII secretion effector
- length: 92
- theoretical pI: 4.35593
- theoretical MW: 9798.67
- GRAVY: -0.56087
⊟Function[edit | edit source]
- TIGRFAM: type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 71)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Prefoldin (CL0200) Prefoldin; Prefoldin subunit (PF02996; HMM-score: 14.9)no clan defined DASH_Duo1; DASH complex subunit Duo1 (PF08651; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.9991
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.040638
- TAT(Tat/SPI): 0.005333
- LIPO(Sec/SPII): 0.037752
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424447 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MMSTVQSDIFKTNSASSSIKSAVETCNNVSKPDKDESTTVSGNNNAHSVIDDLMSKNQSVAEAIRTASDNIQKVGEAFDQTDVMIGNEIGKN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_002566 < EGJ38_002567 < EGJ38_002568
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)