From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2373 [new locus tag: SA_RS13590 ]
  • pan locus tag?: SAUPAN006266000
  • symbol: SA2373
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2373 [new locus tag: SA_RS13590 ]
  • symbol: SA2373
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2662370..2662645
  • length: 276
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGTACAGTTCAAAGTGATATTTTCAAGACTAATAGTGCATCATCATCTATTAAAAGT
    GCCGTTGAAACATGTAATAATGTGTCGAAACCGGATAAAGATGAAAGTACAACAGTAAGT
    GGAAATAATAATGCTCATAGTGTGATAGACGATTTGATTAGTAAGAATCAATCTGTTGCT
    GAAGCAATAAGAAATGCGAGCGATAGTATACAAAAAGTTGGCGAAGAATTTAATCAAACA
    GACGTAATGATTGGTAATGAAATTGGTAAAAATTAA
    60
    120
    180
    240
    276

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2373 [new locus tag: SA_RS13590 ]
  • symbol: SA2373
  • description: hypothetical protein
  • length: 91
  • theoretical pI: 4.37085
  • theoretical MW: 9692.46
  • GRAVY: -0.618681

Function[edit | edit source]

  • TIGRFAM:
    type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 68.5)
  • TheSEED  :
    • FIG01108708: hypothetical protein
  • PFAM:
    Prefoldin (CL0200) Prefoldin; Prefoldin subunit (PF02996; HMM-score: 12.6)
    no clan defined DASH_Duo1; DASH complex subunit Duo1 (PF08651; HMM-score: 10.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0.0012
    • Extracellular Score: 0.9984
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.67
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.032391
    • TAT(Tat/SPI): 0.004826
    • LIPO(Sec/SPII): 0.03841
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSTVQSDIFKTNSASSSIKSAVETCNNVSKPDKDESTTVSGNNNAHSVIDDLISKNQSVAEAIRNASDSIQKVGEEFNQTDVMIGNEIGKN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]