From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2372 [new locus tag: SA_RS13585 ]
  • pan locus tag?: SAUPAN006265000
  • symbol: SA2372
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2372 [new locus tag: SA_RS13585 ]
  • symbol: SA2372
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2661987..2662355
  • length: 369
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCGAATAAACTTGATGGAATCAATAAAATGATCACAGCGAAACATAAGCAAATGGAT
    GACTTATATGATGAAAAGCGAGAGGTTAAAGCTTTGATAGACGAAAGTGATGAGCTTAAT
    CATTCGATAGAACAATTATATCAACATTTAGGTGACCGTTATCATAGTAGCAATATGGCT
    AGTCGTATGGAACAGTTCCGCGATGAATTTCATTTTGCGAAACGACGTTCAACGGAAGCG
    TTATACGAGCAGCAACAGCAAATTCAACATGGCATTCGTAAAGCGGAAGAAGAGATGATT
    GACTTGGAAATGCGAAGGAATGTTGAAATTGAGACGGTGACAAAGGAGGAAAATAAATGG
    AAACAATAG
    60
    120
    180
    240
    300
    360
    369

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2372 [new locus tag: SA_RS13585 ]
  • symbol: SA2372
  • description: hypothetical protein
  • length: 122
  • theoretical pI: 5.61182
  • theoretical MW: 14771.4
  • GRAVY: -1.26066

Function[edit | edit source]

  • TIGRFAM:
    conserved hypothetical protein (TIGR02231; HMM-score: 11.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.1)
  • TheSEED  :
    • FIG01108396: hypothetical protein
  • PFAM:
    no clan defined DUF3958; Protein of unknown function (DUF3958) (PF13125; HMM-score: 22.9)
    and 8 more
    6_Hairpin (CL0059) Beta-AFase-like_GH127_cat; Beta-L-arabinofuranosidase, GH127 catalytic domain (PF07944; HMM-score: 13.7)
    no clan defined FliD_N; Flagellar hook-associated protein 2 N-terminus (PF02465; HMM-score: 13.4)
    Cnl2_NKP2; Cnl2/NKP2 family protein (PF09447; HMM-score: 13.4)
    tRNA_bind_arm (CL0298) Seryl_tRNA_N; Seryl-tRNA synthetase N-terminal domain (PF02403; HMM-score: 11.8)
    no clan defined CCDC90-like; Coiled-coil domain-containing protein 90-like (PF07798; HMM-score: 11.7)
    UBQLN1; Ubiquilin-1-like domain (PF23195; HMM-score: 11.5)
    TssO; Type VI secretion system, TssO (PF17561; HMM-score: 11.4)
    YabA; Initiation control protein YabA (PF06156; HMM-score: 11)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.6457
    • Cytoplasmic Membrane Score: 0.0797
    • Cell wall & surface Score: 0.0047
    • Extracellular Score: 0.27
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002138
    • TAT(Tat/SPI): 0.000293
    • LIPO(Sec/SPII): 0.000348
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSNKLDGINKMITAKHKQMDDLYDEKREVKALIDESDELNHSIEQLYQHLGDRYHSSNMASRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKAEEEMIDLEMRRNVEIETVTKEENKWKQ

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]