Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS13585 [old locus tag: SA2372 ]
- pan locus tag?: SAUPAN006265000
- symbol: SA_RS13585
- pan gene symbol?: lapT2
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS13585 [old locus tag: SA2372 ]
- symbol: SA_RS13585
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2661987..2662355
- length: 369
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCGAATAAACTTGATGGAATCAATAAAATGATCACAGCGAAACATAAGCAAATGGAT
GACTTATATGATGAAAAGCGAGAGGTTAAAGCTTTGATAGACGAAAGTGATGAGCTTAAT
CATTCGATAGAACAATTATATCAACATTTAGGTGACCGTTATCATAGTAGCAATATGGCT
AGTCGTATGGAACAGTTCCGCGATGAATTTCATTTTGCGAAACGACGTTCAACGGAAGCG
TTATACGAGCAGCAACAGCAAATTCAACATGGCATTCGTAAAGCGGAAGAAGAGATGATT
GACTTGGAAATGCGAAGGAATGTTGAAATTGAGACGGTGACAAAGGAGGAAAATAAATGG
AAACAATAG60
120
180
240
300
360
369
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS13585 [old locus tag: SA2372 ]
- symbol: SA_RS13585
- description: hypothetical protein
- length: 122
- theoretical pI: 5.61182
- theoretical MW: 14771.4
- GRAVY: -1.26066
⊟Function[edit | edit source]
- TIGRFAM: conserved hypothetical protein (TIGR02231; HMM-score: 11.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.1)
- TheSEED: see SA2372
- PFAM: no clan defined DUF3958; Protein of unknown function (DUF3958) (PF13125; HMM-score: 22.9)and 8 more6_Hairpin (CL0059) Beta-AFase-like_GH127_cat; Beta-L-arabinofuranosidase, GH127 catalytic domain (PF07944; HMM-score: 13.7)no clan defined FliD_N; Flagellar hook-associated protein 2 N-terminus (PF02465; HMM-score: 13.4)Cnl2_NKP2; Cnl2/NKP2 family protein (PF09447; HMM-score: 13.4)tRNA_bind_arm (CL0298) Seryl_tRNA_N; Seryl-tRNA synthetase N-terminal domain (PF02403; HMM-score: 11.8)no clan defined CCDC90-like; Coiled-coil domain-containing protein 90-like (PF07798; HMM-score: 11.7)UBQLN1; Ubiquilin-1-like domain (PF23195; HMM-score: 11.5)TssO; Type VI secretion system, TssO (PF17561; HMM-score: 11.4)YabA; Initiation control protein YabA (PF06156; HMM-score: 11)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6457
- Cytoplasmic Membrane Score: 0.0797
- Cell wall & surface Score: 0.0047
- Extracellular Score: 0.27
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002138
- TAT(Tat/SPI): 0.000293
- LIPO(Sec/SPII): 0.000348
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNKLDGINKMITAKHKQMDDLYDEKREVKALIDESDELNHSIEQLYQHLGDRYHSSNMASRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKAEEEMIDLEMRRNVEIETVTKEENKWKQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]