From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2523 [new locus tag: SAUSA300_RS14000 ]
  • pan locus tag?: SAUPAN006265000
  • symbol: SAUSA300_2523
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2523 [new locus tag: SAUSA300_RS14000 ]
  • symbol: SAUSA300_2523
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2725766..2726134
  • length: 369
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCGAATAAACTGGATGAAATCAATAAAATAATCACAGCGAAACATGAGCAAATGGAT
    GACTTATATGATGAAAAGCGAGAGGTTAAAGCATTGATAGATGAAAGTGATGCGCTTAAT
    CATTCGATAGATCAATTATATCAACATTTAGGTGAGCGTTATTATAGTAGCAATATGGCT
    AGTCGTATGGAACAGTTCCGCGATGAATTTCATTTTGCGAAACGACGTTCAACGGAAGCG
    TTATACGAGCAGCAACAGCAAATTCAACATGGCATTCGTAAAGTGGAAGAAGAGATGATT
    GACTTGGAAATGCGAAGGAATGTTGAAATTGAGACGGTGACAAAGGAGGAAAATAAATGG
    AAACAATAG
    60
    120
    180
    240
    300
    360
    369

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_2523 [new locus tag: SAUSA300_RS14000 ]
  • symbol: SAUSA300_2523
  • description: hypothetical protein
  • length: 122
  • theoretical pI: 4.93014
  • theoretical MW: 14822.4
  • GRAVY: -1.18279

⊟Function[edit | edit source]

  • TIGRFAM:
    conserved hypothetical protein (TIGR02231; HMM-score: 12.8)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.9)
    and 2 more
    Cellular processes Cellular processes Adaptations to atypical conditions phage shock protein C (TIGR02978; HMM-score: 7.7)
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 5.2)
  • TheSEED  :
    • FIG01108396: hypothetical protein
  • PFAM:
    no clan defined DUF3958; Protein of unknown function (DUF3958) (PF13125; HMM-score: 26.5)
    and 8 more
    FAD-oxidase_C (CL0277) Lact-deh-memb; D-lactate dehydrogenase, membrane binding (PF09330; HMM-score: 15.8)
    no clan defined CCDC90-like; Coiled-coil domain-containing protein 90-like (PF07798; HMM-score: 14.7)
    T3SS-Chaperone (CL0419) YscO-like; YscO-like protein (PF16789; HMM-score: 14.3)
    6_Hairpin (CL0059) Beta-AFase-like_GH127_cat; Beta-L-arabinofuranosidase, GH127 catalytic domain (PF07944; HMM-score: 13.4)
    no clan defined YabA; Initiation control protein YabA (PF06156; HMM-score: 11.4)
    NBD94; Nucleotide-Binding Domain 94 of RH (PF16830; HMM-score: 10.9)
    UPF0242; Uncharacterised protein family (UPF0242) N-terminus (PF06785; HMM-score: 9.7)
    DUF7365; Coiled-coil region of unknown function (DUF7365) (PF24073; HMM-score: 7.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.5926
    • Cytoplasmic Membrane Score: 0.0888
    • Cell wall & surface Score: 0.0062
    • Extracellular Score: 0.3123
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002242
    • TAT(Tat/SPI): 0.001165
    • LIPO(Sec/SPII): 0.000308
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSNKLDEINKIITAKHEQMDDLYDEKREVKALIDESDALNHSIDQLYQHLGERYYSSNMASRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKVEEEMIDLEMRRNVEIETVTKEENKWKQ

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_2523&oldid=84766"