Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2602 [new locus tag: SACOL_RS13620 ]
- pan locus tag?: SAUPAN006265000
- symbol: SACOL2602
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2602 [new locus tag: SACOL_RS13620 ]
- symbol: SACOL2602
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2662462..2662830
- length: 369
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237189 NCBI
- RefSeq: YP_187393 NCBI
- BioCyc: see SACOL_RS13620
- MicrobesOnline: 914072 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCGAATAAACTGGATGAAATCAATAAAATAATCACAGCGAAACATGAGCAAATGGAT
GACTTATATGATGAAAAGCGAGAGGTTAAAGCATTGATAGATGAAAGTGATGCGCTTAAT
CATTCGATAGATCAATTATATCAACATTTAGGTGAGCGTTATTATAGTAGCAATATGGCT
AGTCGTATGGAACAGTTCCGCGATGAATTTCATTTTGCGAAACGACGTTCAACGGAAGCG
TTATACGAGCAGCAACAGCAAATTCAACATGGCATTCGTAAAGTGGAAGAAGAGATGATT
GACTTGGAAATGCGAAGGAATGTTGAAATTGAGACGGTGACAAAGGAGGAAAATAAATGG
AAACAATAG60
120
180
240
300
360
369
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2602 [new locus tag: SACOL_RS13620 ]
- symbol: SACOL2602
- description: hypothetical protein
- length: 122
- theoretical pI: 4.93014
- theoretical MW: 14822.4
- GRAVY: -1.18279
⊟Function[edit | edit source]
- TIGRFAM: conserved hypothetical protein (TIGR02231; HMM-score: 12.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.9)and 2 moreCellular processes Adaptations to atypical conditions phage shock protein C (TIGR02978; HMM-score: 7.7)DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 5.2)
- TheSEED :
- hypothetical protein
- PFAM: FAD-oxidase_C (CL0277) Lact-deh-memb; D-lactate dehydrogenase, membrane binding (PF09330; HMM-score: 15.4)T3SS-Chaperone (CL0419) YscO-like; YscO-like protein (PF16789; HMM-score: 13.7)and 3 moreno clan defined Cnl2_NKP2; Cnl2/NKP2 family protein (PF09447; HMM-score: 10.7)BCLiA (CL0551) Atg14; Vacuolar sorting 38 and autophagy-related subunit 14 (PF10186; HMM-score: 8)no clan defined LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 5.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002242
- TAT(Tat/SPI): 0.001165
- LIPO(Sec/SPII): 0.000308
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNKLDEINKIITAKHEQMDDLYDEKREVKALIDESDALNHSIDQLYQHLGERYYSSNMASRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKVEEEMIDLEMRRNVEIETVTKEENKWKQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell: 62 [2]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]