From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_002567
  • pan locus tag?: SAUPAN006265000
  • symbol: JSNZ_002567
  • pan gene symbol?: lapT2
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_002567
  • symbol: JSNZ_002567
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2574399..2574761
  • length: 363
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCGAATAAACTGGATGAAATCAATAAAATAATCACAGCGAAACATAAGCAAATGGAT
    GACTTATATGATGAAAAGCGAGAGGTTAAAGCATTGATAGATGAAAGTGATGCGCTTAAT
    CATTCGATAGATCAATTATATCAACATTTAGGTGAGCGTTATTATAGTAGCAATATGGCT
    AGTCGTATGGAACAGTTCCGTGATGAATTTCATTTTGCGAAACGACGTTCAACGGAAGCG
    TTATACGAGCAGCAACAGCAAATTCAACATGGCATTCGTAAAGCGGAAGAAGAGATGATT
    GACTTGGAAATGCGAAGGAATGTTGAAATTGAGACGGTGACTTGCAATGGAAACCGTATA
    TAG
    60
    120
    180
    240
    300
    360
    363

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_002567
  • symbol: JSNZ_002567
  • description: hypothetical protein
  • length: 120
  • theoretical pI: 5.2872
  • theoretical MW: 14380
  • GRAVY: -1.045

Function[edit | edit source]

  • TIGRFAM:
    conserved hypothetical protein (TIGR02231; HMM-score: 14.4)
    and 2 more
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 10.3)
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined DUF3958; Protein of unknown function (DUF3958) (PF13125; HMM-score: 22.8)
    and 9 more
    FAD-oxidase_C (CL0277) Lact-deh-memb; D-lactate dehydrogenase, membrane binding (PF09330; HMM-score: 16.5)
    6_Hairpin (CL0059) Beta-AFase-like_GH127_cat; Beta-L-arabinofuranosidase, GH127 catalytic domain (PF07944; HMM-score: 13.4)
    no clan defined YabA; Initiation control protein YabA (PF06156; HMM-score: 12.4)
    CCDC90-like; Coiled-coil domain-containing protein 90-like (PF07798; HMM-score: 12.2)
    TssO; Type VI secretion system, TssO (PF17561; HMM-score: 11.6)
    tRNA_bind_arm (CL0298) Seryl_tRNA_N; Seryl-tRNA synthetase N-terminal domain (PF02403; HMM-score: 11.3)
    no clan defined SlyX; SlyX (PF04102; HMM-score: 11.2)
    NBD94; Nucleotide-Binding Domain 94 of RH (PF16830; HMM-score: 9.5)
    UPF0242; Uncharacterised protein family (UPF0242) N-terminus (PF06785; HMM-score: 9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.5607
    • Cytoplasmic Membrane Score: 0.0771
    • Cell wall & surface Score: 0.0035
    • Extracellular Score: 0.3587
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002274
    • TAT(Tat/SPI): 0.000452
    • LIPO(Sec/SPII): 0.000323
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MSNKLDEINKIITAKHKQMDDLYDEKREVKALIDESDALNHSIDQLYQHLGERYYSSNMASRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKAEEEMIDLEMRRNVEIETVTCNGNRI

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]