Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002700 [new locus tag: EGJ38_RS13480 ]
- pan locus tag?: SAUPAN006490000
- symbol: rnpA
- pan gene symbol?: rnpA
- synonym:
- alternate name: JSNZ_002700
- product: ribonuclease P protein component
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002700 [new locus tag: EGJ38_RS13480 ]
- symbol: rnpA
- product: ribonuclease P protein component
- replicon: chromosome
- strand: -
- coordinates: 2718217..2718570
- length: 354
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424577 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTATTGGAAAAAGCTTACCGAATTAAAAAGAATGCAGATTTTCAGAGAATATATAAA
AAAGGTCATTCTGTAGCCAACAGACAATTTGTTGTATACACTTGTAATAATAAAGAAATA
GACCATTTTCGCTTAGGTATTAGTGTTTCTAAAAAACTAGGTAATGCAGTGTTAAGAAAC
AAGATTAAAAGAGCAATACGTGAAAATTTCAAAGTACATAAGTCGCATATATTGGCCAAA
GATATTATTGTAATAGCAAGACAGCCAGCTAAAGATATGACGACTTTACAAATACAGAAT
AGTCTTGAGCACGTACTTAAAATTGCCAAAGTTTTTAATAAAAAGATTAAGTAA60
120
180
240
300
354
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002700 [new locus tag: EGJ38_RS13480 ]
- symbol: RnpA
- description: ribonuclease P protein component
- length: 117
- theoretical pI: 11.225
- theoretical MW: 13652.2
- GRAVY: -0.417949
⊟Function[edit | edit source]
- reaction: EC 3.1.26.5? ExPASyRibonuclease P Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor
- TIGRFAM: Transcription RNA processing ribonuclease P protein component (TIGR00188; EC 3.1.26.5; HMM-score: 91.6)and 1 moreCell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide deacetylase family protein, PEP-CTERM locus subfamily (TIGR03006; HMM-score: 12.2)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: S5 (CL0329) Ribonuclease_P; Ribonuclease P (PF00825; HMM-score: 111.6)and 1 moreno clan defined ATP-cone; ATP cone domain (PF03477; HMM-score: 14.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8738
- Cytoplasmic Membrane Score: 0.0018
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.1233
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00588
- TAT(Tat/SPI): 0.000385
- LIPO(Sec/SPII): 0.008883
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424577 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLLEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)