Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2739 [new locus tag: SACOL_RS14315 ]
- pan locus tag?: SAUPAN006490000
- symbol: rnpA
- pan gene symbol?: rnpA
- synonym:
- product: ribonuclease P
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2739 [new locus tag: SACOL_RS14315 ]
- symbol: rnpA
- product: ribonuclease P
- replicon: chromosome
- strand: -
- coordinates: 2808624..2808971
- length: 348
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236266 NCBI
- RefSeq: YP_187525 NCBI
- BioCyc: see SACOL_RS14315
- MicrobesOnline: 914205 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301TTGGAAAAAGCTTACCGAATTAAAAAGAATGCAGATTTTCAGAGAATATATAAAAAAGGT
CATTCTGTAGCCAACAGACAATTTGTTGTATACACTTGTAATAATAAAGAAATAGACCAT
TTTCGCTTAGGTATTAGTGTTTCTAAAAAACTAGGTAATGCAGTGTTAAGAAACAAGATT
AAAAGAGCAATACGTGAAAATTTCAAAGTACATAAGTCGCATATATTGGCCAAAGATATT
ATTGTAATAGCAAGACAGCCAGCTAAAGATATGACGACTTTACAAATACAGAATAGTCTT
GAGCACGTACTTAAAATTGCCAAAGTTTTTAATAAAAAGATTAAGTAA60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2739 [new locus tag: SACOL_RS14315 ]
- symbol: RnpA
- description: ribonuclease P
- length: 115
- theoretical pI: 11.225
- theoretical MW: 13425.8
- GRAVY: -0.491304
⊟Function[edit | edit source]
- reaction: EC 3.1.26.5? ExPASyRibonuclease P Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor
- TIGRFAM: Transcription RNA processing ribonuclease P protein component (TIGR00188; EC 3.1.26.5; HMM-score: 92)and 1 moreCell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide deacetylase family protein, PEP-CTERM locus subfamily (TIGR03006; HMM-score: 12.3)
- TheSEED :
- Ribonuclease P protein component (EC 3.1.26.5)
- PFAM: S5 (CL0329) Ribonuclease_P; Ribonuclease P (PF00825; HMM-score: 112.2)and 1 moreno clan defined ATP-cone; ATP cone domain (PF03477; HMM-score: 14.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9137
- Cytoplasmic Membrane Score: 0.0013
- Cell wall & surface Score: 0.0018
- Extracellular Score: 0.0832
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00618
- TAT(Tat/SPI): 0.000432
- LIPO(Sec/SPII): 0.021226
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEKAYRIKKNADFQRIYKKGHSVANRQFVVYTCNNKEIDHFRLGISVSKKLGNAVLRNKIKRAIRENFKVHKSHILAKDIIVIARQPAKDMTTLQIQNSLEHVLKIAKVFNKKIK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell:
- interaction partners:
SACOL1062 (atl) bifunctional autolysin [2] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [2] (data from MRSA252) SACOL1727 (infC) translation initiation factor IF-3 [2] (data from MRSA252) SACOL0033 (mecA) penicillin-binding protein 2' [2] (data from MRSA252) SACOL1390 (parC) DNA topoisomerase IV subunit A [2] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [2] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [2] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [2] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [2] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [2] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [2] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [2] (data from MRSA252) SACOL2232 (rplP) 50S ribosomal protein L16 [2] (data from MRSA252) SACOL2212 (rplQ) 50S ribosomal protein L17 [2] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [2] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [2] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [2] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [2] (data from MRSA252) SACOL2231 (rpmC) 50S ribosomal protein L29 [2] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [2] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [2] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [2] (data from MRSA252) SACOL0437 (rpsF) 30S ribosomal protein S6 [2] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [2] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [2] (data from MRSA252) SACOL2215 (rpsM) 30S ribosomal protein S13 [2] (data from MRSA252) SACOL1292 (rpsO) 30S ribosomal protein S15 [2] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [2] (data from MRSA252) SACOL2235 (rpsS) 30S ribosomal protein S19 [2] (data from MRSA252) SACOL2287 (sarR) accessory regulator R [2] (data from MRSA252) SACOL1449 (sucA) 2-oxoglutarate dehydrogenase E1 component [2] (data from MRSA252) SACOL0303 5'-nucleotidase [2] (data from MRSA252) SACOL0587 hypothetical protein [2] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [2] (data from MRSA252) SACOL1098 hypothetical protein [2] (data from MRSA252) SACOL1753 universal stress protein [2] (data from MRSA252) SACOL1777 serine protease HtrA [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)