From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS00015 [old locus tag: EGJ38_000003 ]
  • pan locus tag?: SAUPAN000009000
  • symbol: yaaA
  • pan gene symbol?: —
  • synonym:
  • product: S4 domain-containing protein YaaA

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS00015 [old locus tag: EGJ38_000003 ]
  • symbol: yaaA
  • product: S4 domain-containing protein YaaA
  • replicon: chromosome
  • strand: +
  • coordinates: 3154..3399
  • length: 246
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (3154..3399) NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    GTGATTATTTTGGTTCAAGAAGTTGTAGTAGAAGGAGACATTAATTTAGGTCAATTTCTA
    AAAACAGAAGGGATTATTGAATCTGGTGGTCAAGCAAAATGGTTCTTGCAAGACGTTGAA
    GTATTAATTAATGGAGTGCGTGAAACACGTCGCGGTAAAAAGTTAGAACATCAAGATCGT
    ATAGATATCCCAGAATTACCTGAAGATGCTGGTTCTTTCTTAATCATTCATCAAGGTGAA
    CAATGA
    60
    120
    180
    240
    246


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_RS00015 [old locus tag: EGJ38_000003 ]
  • symbol: YaaA
  • description: S4 domain-containing protein YaaA
  • length: 81
  • theoretical pI: 4.35578
  • theoretical MW: 9137.35
  • GRAVY: -0.197531

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair S4 domain protein YaaA (TIGR02988; HMM-score: 90)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    S4 (CL0492) S4_2; S4 domain (PF13275; HMM-score: 72.4)
    and 1 more
    SYY_C-terminal; Tyrosine--tRNA ligase SYY-like C-terminal domain (PF22421; HMM-score: 23.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9994
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0004
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002067
    • TAT(Tat/SPI): 0.000157
    • LIPO(Sec/SPII): 0.000268
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001789359 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=EGJ38_RS00015&oldid=116631"