Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0003 [new locus tag: SA_RS00155 ]
- pan locus tag?: SAUPAN000009000
- symbol: SA0003
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0003 [new locus tag: SA_RS00155 ]
- symbol: SA0003
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 3670..3915
- length: 246
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1122774 NCBI
- RefSeq: NP_373241 NCBI
- BioCyc:
- MicrobesOnline: 102267 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGATTATTTTGGTTCAAGAAGTTGTAGTAGAAGGAGACATTAATTTAGGTCAATTTCTA
AAAACAGAAGGGATTATTGAATCTGGTGGTCAAGCAAAATGGTTCTTGCAAGACGTTGAA
GTATTAATTAATGGAGTGCGTGAAACACGTCGCGGTAAAAAGTTAGAACATCAAGATCGT
ATAGATATCCCAGAATTACCTGAAGATGCTGGTTCTTTCTTAATCATTCATCAAGGTGAA
CAATGA60
120
180
240
246
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0003 [new locus tag: SA_RS00155 ]
- symbol: SA0003
- description: hypothetical protein
- length: 81
- theoretical pI: 4.35578
- theoretical MW: 9137.35
- GRAVY: -0.197531
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair S4 domain protein YaaA (TIGR02988; HMM-score: 90)
- TheSEED :
- FIG002958: hypothetical protein
- PFAM: S4 (CL0492) S4_2; S4 domain (PF13275; HMM-score: 74.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002067
- TAT(Tat/SPI): 0.000157
- LIPO(Sec/SPII): 0.000268
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA1533 (ackA) acetate kinase [1] (data from MRSA252) SA0562 (adh1) alcohol dehydrogenase [1] (data from MRSA252) SA2027 (adk) adenylate kinase [1] (data from MRSA252) SA0366 (ahpC) alkyl hydroperoxide reductase [1] (data from MRSA252) SA2428 (arcA) arginine deiminase [1] (data from MRSA252) SA2427 (arcB) ornithine carbamoyltransferase [1] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SA1456 (aspS) aspartyl-tRNA synthetase [1] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [1] (data from MRSA252) SA1518 (citZ) citrate synthase [1] (data from MRSA252) SA0483 (clpC) endopeptidase [1] (data from MRSA252) SA1234 (cspA) cold-shock protein CspA [1] (data from MRSA252) SA2312 (ddh) D-lactate dehydrogenase [1] (data from MRSA252) SA1887 (ddl) D-alanyl-alanine synthetase A [1] (data from MRSA252) SA1940 (deoD) purine nucleoside phosphorylase [1] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SA1941 (dps) general stress protein 20U [1] (data from MRSA252) SA0133 (dra) deoxyribose-phosphate aldolase [1] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SA0545 (eutD) phosphotransacetylase [1] (data from MRSA252) SA1074 (fabG) 3-oxoacyl-ACP reductase [1] (data from MRSA252) SA1901 (fabZ) (3R)-hydroxymyristoyl-ACP dehydratase [1] (data from MRSA252) SA1927 (fbaA) fructose-bisphosphate aldolase [1] (data from MRSA252) SA1206 (femA) factor essential for expression of methicillin resistance [1] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) SA0915 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [1] (data from MRSA252) SA0505 (fus) elongation factor G [1] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [1] (data from MRSA252) SA1715 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [1] (data from MRSA252) SA1959 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SA1150 (glnA) glutamine-ammonia ligase [1] (data from MRSA252) SA0486 (gltX) glutamyl-tRNA synthetase [1] (data from MRSA252) SA1394 (glyS) glycyl-tRNA synthetase [1] (data from MRSA252) SA1342 (gnd) 6-phosphogluconate dehydrogenase [1] (data from MRSA252) SA2204 (gpmA) phosphoglyceromutase [1] (data from MRSA252) SA1836 (groEL) molecular chaperone GroEL [1] (data from MRSA252) SA0819 (gudB) NAD-specific glutamate dehydrogenase [1] (data from MRSA252) SA1305 (hu) DNA-binding protein II [1] (data from MRSA252) SA1036 (ileS) isoleucyl-tRNA synthetase [1] (data from MRSA252) SA0245 (ispD) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) SA1170 (katA) catalase [1] (data from MRSA252) SA0475 (lysS) lysyl-tRNA synthetase [1] (data from MRSA252) SA1704 (map) methionine aminopeptidase [1] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [1] (data from MRSA252) SA2334 (mvaS) 3-hydroxy-3-methylglutaryl-CoA synthase [1] (data from MRSA252) SA0687 (nrdF) ribonucleotide-diphosphate reductase subunit beta [1] (data from MRSA252) SA0494 (nusG) transcription antitermination protein [1] (data from MRSA252) SA1609 (pckA) phosphoenolpyruvate carboxykinase [1] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [1] (data from MRSA252) SA0823 (pgi) glucose-6-phosphate isomerase [1] (data from MRSA252) SA0728 (pgk) phosphoglycerate kinase [1] (data from MRSA252) SA0730 (pgm) phosphoglyceromutase [1] (data from MRSA252) SA0934 (ptsH) phosphocarrier protein HPr [1] (data from MRSA252) SA2341 (rocA) 1-pyrroline-5-carboxylate dehydrogenase [1] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) SA2023 (rpoA) DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) SA0500 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SA1308 (rpsA) 30S ribosomal protein S1 [1] (data from MRSA252) SA2034 (rpsH) 30S ribosomal protein S8 [1] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SA2048 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) SA0503 (rpsL) 30S ribosomal protein S12 [1] (data from MRSA252) SA1382 (sodA) superoxide dismutase SodA [1] (data from MRSA252) SA0107 (spa) immunoglobulin G binding protein A [1] (data from MRSA252) SA1088 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SA0729 (tpiA) triosephosphate isomerase [1] (data from MRSA252) SA1535 (tpx) thiol peroxidase [1] (data from MRSA252) SA0992 (trxA) thioredoxin [1] (data from MRSA252) SA1100 (tsf) elongation factor Ts [1] (data from MRSA252) SA0506 (tuf) elongation factor Tu [1] (data from MRSA252) SA1914 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) SA0342 hypothetical protein [1] (data from MRSA252) SA0437 hypothetical protein [1] (data from MRSA252) SA0605 dihydroxyacetone kinase subunit DhaK [1] (data from MRSA252) SA0618 hypothetical protein [1] (data from MRSA252) SA0627 hypothetical protein [1] (data from MRSA252) SA0637 hypothetical protein [1] (data from MRSA252) SA0641 hypothetical protein [1] (data from MRSA252) SA0759 hypothetical protein [1] (data from MRSA252) SA0859 hypothetical protein [1] (data from MRSA252) SA0873 hypothetical protein [1] (data from MRSA252) SA0941 hypothetical protein [1] (data from MRSA252) SA1359 elongation factor P [1] (data from MRSA252) SA1365 glycine dehydrogenase subunit 2 [1] (data from MRSA252) SA1572 dipeptidase PepV [1] (data from MRSA252) SA1599 translaldolase [1] (data from MRSA252) SA2098 glycerate dehydrogenase [1] (data from MRSA252) SA2378 hypothetical protein [1] (data from MRSA252) SA2395 L-lactate dehydrogenase [1] (data from MRSA252) SA2399 fructose-1,6-bisphosphate aldolase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA0003 > recF > gyrB > gyrA
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 1.70 1.71 1.72 1.73 1.74 1.75 1.76 1.77 1.78 1.79 1.80 1.81 1.82 1.83 1.84 1.85 1.86 1.87 1.88 1.89 1.90 1.91 1.92 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]