Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0934 [new locus tag: SA_RS05295 ]
- pan locus tag?: SAUPAN003303000
- symbol: ptsH
- pan gene symbol?: ptsH
- synonym:
- product: phosphocarrier protein HPr
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0934 [new locus tag: SA_RS05295 ]
- symbol: ptsH
- product: phosphocarrier protein HPr
- replicon: chromosome
- strand: +
- coordinates: 1060659..1060925
- length: 267
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123758 NCBI
- RefSeq: NP_374202 NCBI
- BioCyc: see SA_RS05295
- MicrobesOnline: 103228 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAACAAAATTCATATGTAATCATCGACGAGACTGGTATTCACGCTAGACCAGCAACA
ATGTTAGTACAAACAGCTTCAAAATTCGATTCTGATATTCAATTAGAATATAACGGTAAG
AAAGTAAACTTAAAATCAATCATGGGTGTTATGAGCCTTGGTGTTGGTAAAGATGCTGAA
ATTACAATTTATGCTGACGGTAGTGATGAATCTGACGCCATTCAAGCAATCAGTGACGTC
TTATCAAAAGAAGGATTGACTAAATAA60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0934 [new locus tag: SA_RS05295 ]
- symbol: PtsH
- description: phosphocarrier protein HPr
- length: 88
- theoretical pI: 4.26765
- theoretical MW: 9495.67
- GRAVY: -0.181818
⊟Function[edit | edit source]
- TIGRFAM: Signal transduction PTS phosphocarrier, HPr family (TIGR01003; HMM-score: 113.9)
- TheSEED :
- Phosphocarrier protein of PTS system
and 2 more - PFAM: no clan defined PTS-HPr; PTS HPr component phosphorylation site (PF00381; HMM-score: 108.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9993
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00474
- TAT(Tat/SPI): 0.000465
- LIPO(Sec/SPII): 0.001045
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEQNSYVIIDETGIHARPATMLVQTASKFDSDIQLEYNGKKVNLKSIMGVMSLGVGKDAEITIYADGSDESDAIQAISDVLSKEGLTK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA0366 (ahpC) alkyl hydroperoxide reductase [2] (data from MRSA252) SA2428 (arcA) arginine deiminase [2] (data from MRSA252) SA2427 (arcB) ornithine carbamoyltransferase [2] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [2] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [2] (data from MRSA252) SA0471 (cysK) hypothetical protein [2] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [2] (data from MRSA252) SA0133 (dra) deoxyribose-phosphate aldolase [2] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [2] (data from MRSA252) SA0545 (eutD) phosphotransacetylase [2] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [2] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [2] (data from MRSA252) SA0505 (fus) elongation factor G [2] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [2] (data from MRSA252) SA1959 (glmS) glucosamine--fructose-6-phosphate aminotransferase [2] (data from MRSA252) SA1150 (glnA) glutamine-ammonia ligase [2] (data from MRSA252) SA1836 (groEL) molecular chaperone GroEL [2] (data from MRSA252) SA0376 (guaA) GMP synthase [2] (data from MRSA252) SA0375 (guaB) inositol-monophosphate dehydrogenase [2] (data from MRSA252) SA0232 (lctE) L-lactate dehydrogenase [2] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [2] (data from MRSA252) SA2334 (mvaS) 3-hydroxy-3-methylglutaryl-CoA synthase [2] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [2] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [2] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [2] (data from MRSA252) SA0823 (pgi) glucose-6-phosphate isomerase [2] (data from MRSA252) SA0728 (pgk) phosphoglycerate kinase [2] (data from MRSA252) SA0730 (pgm) phosphoglyceromutase [2] (data from MRSA252) SA1520 (pykA) pyruvate kinase [2] (data from MRSA252) SA2341 (rocA) 1-pyrroline-5-carboxylate dehydrogenase [2] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [2] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [2] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [2] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [2] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA2022 (rplQ) 50S ribosomal protein L17 [2] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [2] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [2] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [2] (data from MRSA252) SA0459 (rplY) 50S ribosomal protein L25 [2] (data from MRSA252) SA0501 (rpoC) DNA-directed RNA polymerase subunit beta' [2] (data from MRSA252) SA1099 (rpsB) 30S ribosomal protein S2 [2] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [2] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [2] (data from MRSA252) SA2034 (rpsH) 30S ribosomal protein S8 [2] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [2] (data from MRSA252) SA2048 (rpsJ) 30S ribosomal protein S10 [2] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [2] (data from MRSA252) SA1116 (rpsO) 30S ribosomal protein S15 [2] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [2] (data from MRSA252) SA1382 (sodA) superoxide dismutase SodA [2] (data from MRSA252) SA0107 (spa) immunoglobulin G binding protein A [2] (data from MRSA252) SA1088 (sucC) succinyl-CoA synthetase subunit beta [2] (data from MRSA252) SA1089 (sucD) succinyl-CoA synthetase subunit alpha [2] (data from MRSA252) SA1506 (thrS) threonyl-tRNA synthetase [2] (data from MRSA252) SA1499 (tig) trigger factor [2] (data from MRSA252) SA1100 (tsf) elongation factor Ts [2] (data from MRSA252) SA0506 (tuf) elongation factor Tu [2] (data from MRSA252) SA1914 (upp) uracil phosphoribosyltransferase [2] (data from MRSA252) SA0437 hypothetical protein [2] (data from MRSA252) SA0477 pyridoxal biosynthesis lyase PdxS [2] (data from MRSA252) SA0627 hypothetical protein [2] (data from MRSA252) SA0637 hypothetical protein [2] (data from MRSA252) SA0641 hypothetical protein [2] (data from MRSA252) SA0802 hypothetical protein [2] (data from MRSA252) SA1271 threonine dehydratase [2] (data from MRSA252) SA1272 alanine dehydrogenase [2] (data from MRSA252) SA1532 hypothetical protein [2] (data from MRSA252) SA1572 dipeptidase PepV [2] (data from MRSA252) SA1709 hypothetical protein [2] (data from MRSA252) SA1743 hypothetical protein [2] (data from MRSA252) SA2395 L-lactate dehydrogenase [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43 2.44 2.45 2.46 2.47 2.48 2.49 2.50 2.51 2.52 2.53 2.54 2.55 2.56 2.57 2.58 2.59 2.60 2.61 2.62 2.63 2.64 2.65 2.66 2.67 2.68 2.69 2.70 2.71 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)