Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS09935 [old locus tag: EGJ38_001990 ]
- pan locus tag?: SAUPAN005276000
- symbol: agrD
- pan gene symbol?: agrD
- synonym:
- product: cyclic lactone autoinducer peptide AIP-III precursor
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS09935 [old locus tag: EGJ38_001990 ]
- symbol: agrD
- product: cyclic lactone autoinducer peptide AIP-III precursor
- replicon: chromosome
- strand: +
- coordinates: 2004210..2004350
- length: 141
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (2004210..2004350) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAAAAATTACTCAACAAAGTTATTGAGCTTTTAGTTGACTTTTTCAACAGCATCGGT
TACAGAGCCGCGTATATAAATTGTGATTTTTTATTGGACGAAGCTGAAGTACCAAAAGAA
TTAACTCAATTACACGAATAA60
120
141
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS09935 [old locus tag: EGJ38_001990 ]
- symbol: AgrD
- description: cyclic lactone autoinducer peptide AIP-III precursor
- length: 46
- theoretical pI: 4.53515
- theoretical MW: 5385.24
- GRAVY: 0.0717391
⊟Function[edit | edit source]
- TIGRFAM: cyclic lactone autoinducer peptide (TIGR04223; HMM-score: 29.5)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined AgrD; Staphylococcal AgrD protein (PF05931; HMM-score: 48.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.3464
- Cytoplasmic Membrane Score: 0.2639
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.3894
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.063074
- TAT(Tat/SPI): 0.001213
- LIPO(Sec/SPII): 0.015083
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000735197 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKKLLNKVIELLVDFFNSIGYRAAYINCDFLLDEAEVPKELTQLHE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: AgrA, CodY see EGJ38_001990
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]