Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000708
- pan locus tag?: SAUPAN002641000
- symbol: JSNZ_000708
- pan gene symbol?: —
- synonym:
- product: CHY zinc finger protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000708
- symbol: JSNZ_000708
- product: CHY zinc finger protein
- replicon: chromosome
- strand: -
- coordinates: 743468..743782
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCCTAAAGTTTATGGTTCATTAATCGATACTGAAACACGCTGTCGCCATTATTTTACC
GAAGAAGATATTATTGCTATTAAATTTAAATGTTGTAATAAATACTATCCATGCTATAAG
TGCCATAATGAGTTTGAAAAGCACGCCATTAAGCGTTGGTCTGAGCCTTCATTTAACGAA
AAAGCAATCTTATGCGGTGTATGCAAACACGAATTAACAATCAATGAATATATGATGGTA
GAGCGTTGTCCAAATTGCCAATCTCGGTTTAACAATCGCTGTAAATATCACTATCATATT
TATTTTGAAATTTAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000708
- symbol: JSNZ_000708
- description: CHY zinc finger protein
- length: 104
- theoretical pI: 8.09137
- theoretical MW: 12723.7
- GRAVY: -0.645192
⊟Function[edit | edit source]
- TIGRFAM: MJ0042 family finger-like domain (TIGR02098; HMM-score: 11)and 1 moreProtein fate Protein modification and repair hydrogenase nickel insertion protein HypA (TIGR00100; HMM-score: 7.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman
- PFAM: no clan defined zf-CHY; CHY zinc finger (PF05495; HMM-score: 46.8)and 5 moreTbcl_zf (CL0839) LIM; LIM domain (PF00412; HMM-score: 17.5)no clan defined Zf_2nd_IFT121; IFT121, second zinc finger domain (PF23145; HMM-score: 16.1)RING (CL0229) IBR_1; IBR domain (PF22191; HMM-score: 15.8)Zn_Beta_Ribbon (CL0167) Zn_ribbon_9; C4-type zinc ribbon domain (PF02591; HMM-score: 13.7)HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 8.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9667
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0331
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.183656
- TAT(Tat/SPI): 0.000783
- LIPO(Sec/SPII): 0.009195
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MPKVYGSLIDTETRCRHYFTEEDIIAIKFKCCNKYYPCYKCHNEFEKHAIKRWSEPSFNEKAILCGVCKHELTINEYMMVERCPNCQSRFNNRCKYHYHIYFEI
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_000708 < murB
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)