(Redirected from JSNZ 000840)
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000840 [new locus tag: EGJ38_RS04195 ]
- pan locus tag?: SAUPAN002959000
- symbol: EGJ38_000840
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000840
- product: DUF1381 domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000840 [new locus tag: EGJ38_RS04195 ]
- symbol: EGJ38_000840
- product: DUF1381 domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 851294..851500
- length: 207
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422815 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGACACAATACTTAGTCACAACATTCAAAGATTCAACAGGACAACCACATGAACATTTT
ACTACTGCTAGAGATAATCAGACGTTTACAGTTGTTGAGGCAGAGAGTAAAGAAGAAGCG
AAAGAAAAGTACGAGGCACAAGTTAAAAGAGATGCAATTATTAAATTAGGTCAGTTGTTT
GAAAATATAAGGGAGTGTCGGAAATGA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000840 [new locus tag: EGJ38_RS04195 ]
- symbol: EGJ38_000840
- description: DUF1381 domain-containing protein
- length: 68
- theoretical pI: 6.51993
- theoretical MW: 7964.87
- GRAVY: -0.942647
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined DUF1381; Protein of unknown function (DUF1381) (PF07129; HMM-score: 109)and 2 more4H_Cytokine (CL0053) IL7; Interleukin 7 (PF01415; HMM-score: 17)no clan defined YhzD; YhzD-like protein (PF14120; HMM-score: 10.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9665
- Cytoplasmic Membrane Score: 0.0015
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0318
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006138
- TAT(Tat/SPI): 0.000339
- LIPO(Sec/SPII): 0.001724
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422815 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTQYLVTTFKDSTGQPHEHFTTARDNQTFTVVEAESKEEAKEKYEAQVKRDAIIKLGQLFENIRECRK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000832 > EGJ38_000833 > EGJ38_000834 > EGJ38_000835 > EGJ38_000836 > EGJ38_000837 > EGJ38_000838 > EGJ38_000839 > EGJ38_000840 > EGJ38_000841 > EGJ38_000842 > rinB > EGJ38_000844 > EGJ38_000845
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)