From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_002306
  • pan locus tag?: SAUPAN005831000
  • symbol: JSNZ_002306
  • pan gene symbol?: —
  • synonym:
  • product: YnfA family protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_002306
  • symbol: JSNZ_002306
  • product: YnfA family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2304426..2304752
  • length: 327
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTATATCCGATTTTTATATTTATATTAGCTGGCTTATGTGAAATAGGTGGGGGATAC
    CTGATTTGGCTGTGGCTTAGGGAAGGACAGTCTTCACTTGTTGGGCTAATAGGCGGTGCG
    ATACTCATGTTATATGGTGTCATTGCGACATTTCAATCATTTCCATCATTCGGAAGAGTA
    TATGCAGCATATGGTGGCGTATTTATCATCATGAGTTTGATTTTTGCGATGGTCGTAGAT
    AAACAAATGTCAGATAAATATGATGTTATCGGTGCAATCATTTGTATTGTAGGTGTTTTA
    GTAATGTTGCTACCCAGCAGAGCTTGA
    60
    120
    180
    240
    300
    327

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_002306
  • symbol: JSNZ_002306
  • description: YnfA family protein
  • length: 108
  • theoretical pI: 6.37731
  • theoretical MW: 11748.2
  • GRAVY: 1.27315

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    DMT (CL0184) UPF0060; Uncharacterised BCR, YnfA/UPF0060 family (PF02694; HMM-score: 136)
    and 7 more
    Mg_trans_NIPA; Magnesium transporter NIPA (PF05653; HMM-score: 16.8)
    no clan defined DUF6518; Family of unknown function (DUF6518) (PF20128; HMM-score: 14.8)
    DUF6458; Domain of unknown function (DUF6458) (PF20059; HMM-score: 13.8)
    DMT (CL0184) EamA; EamA-like transporter family (PF00892; HMM-score: 13.6)
    no clan defined DUF6264; Family of unknown function (DUF6264) (PF19779; HMM-score: 12.9)
    DUF6056; Family of unknown function (DUF6056) (PF19528; HMM-score: 11)
    SdpI; SdpI/YfhL protein family (PF13630; HMM-score: 7.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9997
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0003
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004115
    • TAT(Tat/SPI): 0.000221
    • LIPO(Sec/SPII): 0.057069
  • predicted transmembrane helices (TMHMM): 4

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRVYAAYGGVFIIMSLIFAMVVDKQMSDKYDVIGAIICIVGVLVMLLPSRA

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=JSNZ_002306&oldid=107947"