Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2240 [new locus tag: NWMN_RS12910 ]
- pan locus tag?: SAUPAN005831000
- symbol: NWMN_2240
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2240 [new locus tag: NWMN_RS12910 ]
- symbol: NWMN_2240
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2463390..2463716
- length: 327
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331359 NCBI
- RefSeq: YP_001333274 NCBI
- BioCyc:
- MicrobesOnline: 3707842 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTATATCCGATTTTTATATTTATATTAGCTGGCTTATGTGAAATAGGTGGGGGATAC
CTGATTTGGCTGTGGCTTAGGGAAGGACAGTCTTCACTTGTTGGGCTAATAGGCGGTGCG
ATACTCATGTTATATGGTGTCATTGCGACATTTCAATCATTTCCATCATTCGGAAGAGTA
TATGCAGCATATGGTGGCGTATTTATCATCATGAGTTTGATTTTTGCGATGGTCGTAGAT
AAACAAATGCCAGATAAATATGATGTTATCGGTGCAATCATTTGTATTGTAGGTGTTTTA
GTAATGTTGCTACCCAGCAGAGCTTGA60
120
180
240
300
327
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2240 [new locus tag: NWMN_RS12910 ]
- symbol: NWMN_2240
- description: hypothetical protein
- length: 108
- theoretical pI: 6.37731
- theoretical MW: 11758.3
- GRAVY: 1.26574
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Protein of unknown function UPF0060
- PFAM: DMT (CL0184) UPF0060; Uncharacterised BCR, YnfA/UPF0060 family (PF02694; HMM-score: 138)and 7 moreEamA; EamA-like transporter family (PF00892; HMM-score: 18)Mg_trans_NIPA; Magnesium transporter NIPA (PF05653; HMM-score: 16.4)no clan defined DUF6056; Family of unknown function (DUF6056) (PF19528; HMM-score: 13.4)DUF6264; Family of unknown function (DUF6264) (PF19779; HMM-score: 12.2)Frag1-like (CL0412) DUF998; Protein of unknown function (DUF998) (PF06197; HMM-score: 9.3)no clan defined DUF6458; Domain of unknown function (DUF6458) (PF20059; HMM-score: 8.2)SdpI; SdpI/YfhL protein family (PF13630; HMM-score: 7.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9997
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004115
- TAT(Tat/SPI): 0.000221
- LIPO(Sec/SPII): 0.057069
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRVYAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]