From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2130 [new locus tag: SA_RS12240 ]
  • pan locus tag?: SAUPAN005831000
  • symbol: SA2130
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2130 [new locus tag: SA_RS12240 ]
  • symbol: SA2130
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2395351..2395677
  • length: 327
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTATATCCGATTTTTATATTTATATTAGCTGGCTTATGTGAAATAGGTGGGGGATAC
    CTGATTTGGCTGTGGCTTAGGGAAGGACAGTCTTCACTTGTTGGGCTAATAGGCGGTGCG
    ATACTCATGTTATATGGTGTCATTGCGACATTTCAATCATTTCCATCATTCGGAAGAGTA
    TATGCAGCATATGGTGGCGTATTTATCATCATGAGTTTGATTTTTGCGATGGTCGTAGAT
    AAACAAATGCCAGATAAATATGATGTTATCGGTGCAATCATTTGTATTGTAGGTGTTTTA
    GTAATGTTGCTACCCAGCAGAGCTTGA
    60
    120
    180
    240
    300
    327

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2130 [new locus tag: SA_RS12240 ]
  • symbol: SA2130
  • description: hypothetical protein
  • length: 108
  • theoretical pI: 6.37731
  • theoretical MW: 11758.3
  • GRAVY: 1.26574

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Protein of unknown function UPF0060
  • PFAM:
    DMT (CL0184) UPF0060; Uncharacterised BCR, YnfA/UPF0060 family (PF02694; HMM-score: 138)
    and 7 more
    EamA; EamA-like transporter family (PF00892; HMM-score: 18)
    Mg_trans_NIPA; Magnesium transporter NIPA (PF05653; HMM-score: 16.4)
    no clan defined DUF6056; Family of unknown function (DUF6056) (PF19528; HMM-score: 13.4)
    DUF6264; Family of unknown function (DUF6264) (PF19779; HMM-score: 12.2)
    Frag1-like (CL0412) DUF998; Protein of unknown function (DUF998) (PF06197; HMM-score: 9.3)
    no clan defined DUF6458; Domain of unknown function (DUF6458) (PF20059; HMM-score: 8.2)
    SdpI; SdpI/YfhL protein family (PF13630; HMM-score: 7.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9997
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0003
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004115
    • TAT(Tat/SPI): 0.000221
    • LIPO(Sec/SPII): 0.057069
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRVYAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]