Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0295 [new locus tag: NWMN_RS01685 ]
- pan locus tag?: SAUPAN000611000
- symbol: NWMN_0295
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0295 [new locus tag: NWMN_RS01685 ]
- symbol: NWMN_0295
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 344123..344473
- length: 351
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 5330134 NCBI
- RefSeq: YP_001331329 NCBI
- BioCyc:
- MicrobesOnline: 3705826 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACTCTTTATGAAGATGTTAAACTTTTACTCAAGAAAAATGGAGTGGAAGTTAAAAGT
GATGAAGAAGAAATATTTAAGATGGAAGTTGACGGAATACTAGAAGATGTTAGGGATATA
ACAAACAATGATTTTATGAAAGATGGTCAAGTCATTTATCCTTACTCAATCAAAAAGTAT
GTCGCAGACGTCCTAGAGTATTATCAACGACCTGAAGTTAAAAAGAATTTAAAGTCAAGA
AGTATGGGGACAGTGTCGTACACTTATAACGATGGTGTCCCTGATTACATTAGTGGAGTA
TTAAACAGGTATAAACGAGCAAAGTTTCATCCGTTTAAATCAATAAGGTAG60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0295 [new locus tag: NWMN_RS01685 ]
- symbol: NWMN_0295
- description: hypothetical protein
- length: 116
- theoretical pI: 8.67293
- theoretical MW: 13659.6
- GRAVY: -0.644828
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General death-on-curing family protein (TIGR01550; HMM-score: 12.6)
- TheSEED :
- Phage capsid and scaffold
- PFAM: no clan defined LED_rpt; LED repeat (PF20854; HMM-score: 13.9)Adhesin (CL0204) Collagen_bind; Collagen binding domain (PF05737; HMM-score: 13.7)YqbG (CL0643) Phage_connect_1; Phage gp6-like head-tail connector protein (PF05135; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7717
- Cytoplasmic Membrane Score: 0.0272
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.2007
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002603
- TAT(Tat/SPI): 0.000431
- LIPO(Sec/SPII): 0.000875
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTLYEDVKLLLKKNGVEVKSDEEEIFKMEVDGILEDVRDITNNDFMKDGQVIYPYSIKKYVADVLEYYQRPEVKKNLKSRSMGTVSYTYNDGVPDYISGVLNRYKRAKFHPFKSIR
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]