From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0916 [new locus tag: NWMN_RS05130 ]
  • pan locus tag?: SAUPAN003249000
  • symbol: sspC
  • pan gene symbol?: sspC
  • synonym:
  • product: cysteine protease precursor

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0916 [new locus tag: NWMN_RS05130 ]
  • symbol: sspC
  • product: cysteine protease precursor
  • replicon: chromosome
  • strand: -
  • coordinates: 1014559..1014888
  • length: 330
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTATCAACTACAATTTATAAATTTAGTTTACGACACAACCAAACTCACACATCTAGAA
    CAAACCAATATCAATTTATTCATTGGTAATTGGAGTAATCATCAATTACAAAAATCAATT
    TGTATACGTCATGGCGATGATACAAGTCACAATCAATATCATATTCTTTTTATAGATACG
    GCACATCAACGCATTAAATTTTCATCTATTGATAATGAAGAAATCATTTATATTCTTGAT
    TATGATGATACACAGCATATCCTCATGCAAACGTCATCCAAACAAGGTATTGGCACTTCG
    CGACCAATCGTTTATGAGCGCTTAGTATAA
    60
    120
    180
    240
    300
    330


Protein[edit | edit source]

Protein Data Bank: 1PXV
Protein Data Bank: 1Y4H

General[edit | edit source]

  • locus tag: NWMN_0916 [new locus tag: NWMN_RS05130 ]
  • symbol: SspC
  • description: cysteine protease precursor
  • length: 109
  • theoretical pI: 6.38356
  • theoretical MW: 12881.4
  • GRAVY: -0.410092

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Staphostatin B
  • PFAM:
    bBprotInhib (CL0354) Staphostatin_B; Staphostatin B (PF09023; HMM-score: 243)
    and 2 more
    Staphostatin_A; Staphostatin A (PF09022; HMM-score: 27.5)
    Lysozyme (CL0037) T6SS_VgrG3-like_C; Type VI secretion system spike protein VgrG3-like, C-terminal (PF21277; HMM-score: 12)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7247
    • Cytoplasmic Membrane Score: 0.0125
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.2625
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005984
    • TAT(Tat/SPI): 0.000137
    • LIPO(Sec/SPII): 0.000745
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]