From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00986
  • pan locus tag?: SAUPAN003249000
  • symbol: SAOUHSC_00986
  • pan gene symbol?: sspC
  • synonym:
  • product: cysteine protease

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00986
  • symbol: SAOUHSC_00986
  • product: cysteine protease
  • replicon: chromosome
  • strand: -
  • coordinates: 957786..958115
  • length: 330
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTATCAACTACAATTTATAAATTTAGTTTACGACACAACCAAACTCACACATCTAGAA
    CAAACCAATATCAATTTATTCATTGGTAATTGGAGTAATCATCAATTACAAAAATCAATT
    TGTATACGTCATGGCGATGATACAAGTCACAATCAATATCATATTCTTTTTATAGATACG
    GCACATCAACGCATTAAATTTTCATCTATTGATAATGAAGAAATCATTTATATTCTTGAT
    TATGATGATACACAGCATATCCTCATGCAAACGTCATCCAAACAAGGTATTGGCACTTCG
    CGACCAATCGTTTATGAGCGCTTAGTATAA
    60
    120
    180
    240
    300
    330

⊟Protein[edit | edit source]

Protein Data Bank: 1PXV
Protein Data Bank: 1Y4H

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00986
  • symbol: SAOUHSC_00986
  • description: cysteine protease
  • length: 109
  • theoretical pI: 6.38356
  • theoretical MW: 12881.4
  • GRAVY: -0.410092

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Staphostatin B
  • PFAM:
    bBprotInhib (CL0354) Staphostatin_B; Staphostatin B (PF09023; HMM-score: 247.3)
    and 1 more
    Staphostatin_A; Staphostatin A (PF09022; HMM-score: 27.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005984
    • TAT(Tat/SPI): 0.000137
    • LIPO(Sec/SPII): 0.000745
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

J A Lindsay, S J Foster
Interactive regulatory pathways control virulence determinant production and stability in response to environmental conditions in Staphylococcus aureus.
Mol Gen Genet: 1999, 262(2);323-31
[PubMed:10517329] [WorldCat.org] [DOI] (P p)K Rice, R Peralta, D Bast, J de Azavedo, M J McGavin
Description of staphylococcus serine protease (ssp) operon in Staphylococcus aureus and nonpolar inactivation of sspA-encoded serine protease.
Infect Immun: 2001, 69(1);159-69
[PubMed:11119502] [WorldCat.org] [DOI] (P p)Isabella Massimi, Ellen Park, Kelly Rice, Werner Muller-Esterl, Daniel Sauder, Martin J McGavin
Identification of a novel maturation mechanism and restricted substrate specificity for the SspB cysteine protease of Staphylococcus aureus.
J Biol Chem: 2002, 277(44);41770-7
[PubMed:12207024] [WorldCat.org] [DOI] (P p)Renata Filipek, Malgorzata Rzychon, Aneta Oleksy, Milosz Gruca, Adam Dubin, Jan Potempa, Matthias Bochtler
The Staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease.
J Biol Chem: 2003, 278(42);40959-66
[PubMed:12874290] [WorldCat.org] [DOI] (P p)Malgorzata Rzychon, Artur Sabat, Klaudia Kosowska, Jan Potempa, Adam Dubin
Staphostatins: an expanding new group of proteinase inhibitors with a unique specificity for the regulation of staphopains, Staphylococcus spp. cysteine proteinases.
Mol Microbiol: 2003, 49(4);1051-66
[PubMed:12890028] [WorldCat.org] [DOI] (P p)Lindsey Shaw, Ewa Golonka, Jan Potempa, Simon J Foster
The role and regulation of the extracellular proteases of Staphylococcus aureus.
Microbiology (Reading): 2004, 150(Pt 1);217-228
[PubMed:14702415] [WorldCat.org] [DOI] (P p)Renata Filipek, Jan Potempa, Matthias Bochtler
A comparison of staphostatin B with standard mechanism serine protease inhibitors.
J Biol Chem: 2005, 280(15);14669-74
[PubMed:15644332] [WorldCat.org] [DOI] (P p)Lindsey N Shaw, Ewa Golonka, Grzegorz Szmyd, Simon J Foster, James Travis, Jan Potempa
Cytoplasmic control of premature activation of a secreted protease zymogen: deletion of staphostatin B (SspC) in Staphylococcus aureus 8325-4 yields a profound pleiotropic phenotype.
J Bacteriol: 2005, 187(5);1751-62
[PubMed:15716447] [WorldCat.org] [DOI] (P p)

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_00986&oldid=100519"