Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0949 [new locus tag: SAUSA300_RS05100 ]
- pan locus tag?: SAUPAN003249000
- symbol: sspC
- pan gene symbol?: sspC
- synonym:
- product: cysteine protease
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0949 [new locus tag: SAUSA300_RS05100 ]
- symbol: sspC
- product: cysteine protease
- replicon: chromosome
- strand: -
- coordinates: 1037912..1038241
- length: 330
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913678 NCBI
- RefSeq: YP_493647 NCBI
- BioCyc: see SAUSA300_RS05100
- MicrobesOnline: 1292464 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTATCAACTACAATTTATAAATTTAGTTTACGACACAACCAAACTCACACATCTAGAA
CAAACCAATATCAATTTATTCATTGGTAATTGGAGTAATCATCAATTACAAAAATCAATT
TGTATACGTCATGGCGATGATACAAGTCACAATCAATATCATATTCTTTTTATAGATACG
GCACATCAACGCATTAAATTTTCATCTATTGATAATGAAGAAATCATTTATATTCTTGAT
TATGATGATACACAGCATATCCTCATGCAAACGTCATCCAAACAAGGTATTGGCACTTCG
CGACCAATCGTTTATGAGCGCTTAGTATAA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0949 [new locus tag: SAUSA300_RS05100 ]
- symbol: SspC
- description: cysteine protease
- length: 109
- theoretical pI: 6.38356
- theoretical MW: 12881.4
- GRAVY: -0.410092
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Staphostatin B
- PFAM: bBprotInhib (CL0354) Staphostatin_B; Staphostatin B (PF09023; HMM-score: 243)and 2 moreStaphostatin_A; Staphostatin A (PF09022; HMM-score: 27.5)Lysozyme (CL0037) T6SS_VgrG3-like_C; Type VI secretion system spike protein VgrG3-like, C-terminal (PF21277; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7247
- Cytoplasmic Membrane Score: 0.0125
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.2625
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005984
- TAT(Tat/SPI): 0.000137
- LIPO(Sec/SPII): 0.000745
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: sspC < sspB < sspA
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]