Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1072 [new locus tag: NWMN_RS06075 ]
- pan locus tag?: SAUPAN003416000
- symbol: NWMN_1072
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1072 [new locus tag: NWMN_RS06075 ]
- symbol: NWMN_1072
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1175555..1175788
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330659 NCBI
- RefSeq: YP_001332106 NCBI
- BioCyc:
- MicrobesOnline: 3706623 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGTTTTTAATGATTGGGAAATTAACGTTGTATACTCAGGAGAGCATGAGGTTGTAACA
AACGAAAAGAGTTTATTTGTCATTGACGAATTTTACGATGTTGCAATCGCAATCTATTAT
TTAGATGGAAAATTAAAAGTAGCTCATGTCAACTATGGTTCTGATTTTACAATTGACGTA
GCTAATAAAGTTTTTGAATTGAATATTCAAAATCCAAATGTTGATGAGCATTAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1072 [new locus tag: NWMN_RS06075 ]
- symbol: NWMN_1072
- description: hypothetical protein
- length: 77
- theoretical pI: 4.03259
- theoretical MW: 8898.84
- GRAVY: -0.0519481
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108519: hypothetical protein
- PFAM: no clan defined PgpA; Phosphatidylglycerophosphatase A (PF04608; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6122
- Cytoplasmic Membrane Score: 0.0149
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.3725
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00253
- TAT(Tat/SPI): 0.000094
- LIPO(Sec/SPII): 0.000516
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDVANKVFELNIQNPNVDEH
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
NWMN_1587 (citC) isocitrate dehydrogenase [1] (data from MRSA252) NWMN_1468 (glyS) glycyl-tRNA synthetase [1] (data from MRSA252) NWMN_0877 (ppnK) inorganic polyphosphate/ATP-NAD kinase [1] (data from MRSA252) NWMN_0501 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_2133 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) NWMN_2145 (rplP) 50S ribosomal protein L16 [1] (data from MRSA252) NWMN_1572 (rplT) 50S ribosomal protein L20 [1] (data from MRSA252) NWMN_1549 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_2146 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_2127 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) NWMN_0507 (rpsL) 30S ribosomal protein S12 [1] (data from MRSA252) NWMN_1488 (rpsT) 30S ribosomal protein S20 [1] (data from MRSA252) NWMN_1155 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) NWMN_1607 (tpx) thiol peroxidase [1] (data from MRSA252) NWMN_0443 hypothetical protein [1] (data from MRSA252) NWMN_0481 pyridoxal biosynthesis lyase PdxS [1] (data from MRSA252) NWMN_0641 hypothetical protein [1] (data from MRSA252) NWMN_2217 phosphosugar-binding transcriptional regulator RpiR family protein [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)