Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1172 [new locus tag: SACOL_RS06005 ]
- pan locus tag?: SAUPAN003416000
- symbol: SACOL1172
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1172 [new locus tag: SACOL_RS06005 ]
- symbol: SACOL1172
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1179364..1179597
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238597 NCBI
- RefSeq: YP_186035 NCBI
- BioCyc: see SACOL_RS06005
- MicrobesOnline: 912639 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGTTTTTAATGATTGGGAAATTAACGTTGTATACTCAGGAGAGCATGAGGTTGTAACA
AACGAAAAGAGTTTATTTGTCATTGACGAATTTTACGATGTTGCAATCGCAATCTATTAT
TTAGATGGAAAATTAAAAGTAGCTCATGTCAACTATGGTTCTGATTTTACAATTGACGTA
GCTAATAAAGTTTTTGAATTGAATATTCAAAATCCAAATGTTGATGAGCATTAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1172 [new locus tag: SACOL_RS06005 ]
- symbol: SACOL1172
- description: hypothetical protein
- length: 77
- theoretical pI: 4.03259
- theoretical MW: 8898.84
- GRAVY: -0.0519481
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108519: hypothetical protein
- PFAM: no clan defined PgpA; Phosphatidylglycerophosphatase A (PF04608; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6122
- Cytoplasmic Membrane Score: 0.0149
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.3725
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00253
- TAT(Tat/SPI): 0.000094
- LIPO(Sec/SPII): 0.000516
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDVANKVFELNIQNPNVDEH
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell: 809 [2]
- interaction partners:
SACOL1622 (glyS) glycyl-tRNA synthetase [3] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [3] (data from MRSA252) SACOL1011 (ppnK) inorganic polyphosphate/ATP-NAD kinase [3] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [3] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [3] (data from MRSA252) SACOL2232 (rplP) 50S ribosomal protein L16 [3] (data from MRSA252) SACOL1725 (rplT) 50S ribosomal protein L20 [3] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [3] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [3] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [3] (data from MRSA252) SACOL0591 (rpsL) 30S ribosomal protein S12 [3] (data from MRSA252) SACOL1642 (rpsT) 30S ribosomal protein S20 [3] (data from MRSA252) SACOL1262 (sucC) succinyl-CoA synthetase subunit beta [3] (data from MRSA252) SACOL1762 (tpx) thiol peroxidase [3] (data from MRSA252) SACOL0521 hypothetical protein [3] (data from MRSA252) SACOL0564 pyridoxal biosynthesis lyase PdxS [3] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [3] (data from MRSA252) SACOL2308 RpiR family phosphosugar-binding transcriptional regulator [3] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 3.00 3.01 3.02 3.03 3.04 3.05 3.06 3.07 3.08 3.09 3.10 3.11 3.12 3.13 3.14 3.15 3.16 3.17 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)