From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1172 [new locus tag: SACOL_RS06005 ]
  • pan locus tag?: SAUPAN003416000
  • symbol: SACOL1172
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1172 [new locus tag: SACOL_RS06005 ]
  • symbol: SACOL1172
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1179364..1179597
  • length: 234
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGTTTTTAATGATTGGGAAATTAACGTTGTATACTCAGGAGAGCATGAGGTTGTAACA
    AACGAAAAGAGTTTATTTGTCATTGACGAATTTTACGATGTTGCAATCGCAATCTATTAT
    TTAGATGGAAAATTAAAAGTAGCTCATGTCAACTATGGTTCTGATTTTACAATTGACGTA
    GCTAATAAAGTTTTTGAATTGAATATTCAAAATCCAAATGTTGATGAGCATTAA
    60
    120
    180
    234

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1172 [new locus tag: SACOL_RS06005 ]
  • symbol: SACOL1172
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 4.03259
  • theoretical MW: 8898.84
  • GRAVY: -0.0519481

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108519: hypothetical protein
  • PFAM:
    no clan defined DUF4860; Domain of unknown function (DUF4860) (PF16152; HMM-score: 13.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00253
    • TAT(Tat/SPI): 0.000094
    • LIPO(Sec/SPII): 0.000516
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDVANKVFELNIQNPNVDEH

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell: 809 [2]
  • interaction partners:
    SACOL1622(glyS)glycyl-tRNA synthetase  [3] (data from MRSA252)
    SACOL1741(icd)isocitrate dehydrogenase  [3] (data from MRSA252)
    SACOL1011(ppnK)inorganic polyphosphate/ATP-NAD kinase  [3] (data from MRSA252)
    SACOL0585(rplJ)50S ribosomal protein L10  [3] (data from MRSA252)
    SACOL2220(rplO)50S ribosomal protein L15  [3] (data from MRSA252)
    SACOL2232(rplP)50S ribosomal protein L16  [3] (data from MRSA252)
    SACOL1725(rplT)50S ribosomal protein L20  [3] (data from MRSA252)
    SACOL1702(rplU)50S ribosomal protein L21  [3] (data from MRSA252)
    SACOL2233(rpsC)30S ribosomal protein S3  [3] (data from MRSA252)
    SACOL2214(rpsK)30S ribosomal protein S11  [3] (data from MRSA252)
    SACOL0591(rpsL)30S ribosomal protein S12  [3] (data from MRSA252)
    SACOL1642(rpsT)30S ribosomal protein S20  [3] (data from MRSA252)
    SACOL1262(sucC)succinyl-CoA synthetase subunit beta  [3] (data from MRSA252)
    SACOL1762(tpx)thiol peroxidase  [3] (data from MRSA252)
    SACOL0521hypothetical protein  [3] (data from MRSA252)
    SACOL0564pyridoxal biosynthesis lyase PdxS  [3] (data from MRSA252)
    SACOL0731LysR family transcriptional regulator  [3] (data from MRSA252)
    SACOL2308RpiR family phosphosugar-binding transcriptional regulator  [3] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  2. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  3. ↑ 3.00 3.01 3.02 3.03 3.04 3.05 3.06 3.07 3.08 3.09 3.10 3.11 3.12 3.13 3.14 3.15 3.16 3.17 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL1172&oldid=76543"