From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06075 [old locus tag: NWMN_1072 ]
  • pan locus tag?: SAUPAN003416000
  • symbol: NWMN_RS06075
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS06075 [old locus tag: NWMN_1072 ]
  • symbol: NWMN_RS06075
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1175555..1175788
  • length: 234
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1175555..1175788) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1072

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGTTTTTAATGATTGGGAAATTAACGTTGTATACTCAGGAGAGCATGAGGTTGTAACA
    AACGAAAAGAGTTTATTTGTCATTGACGAATTTTACGATGTTGCAATCGCAATCTATTAT
    TTAGATGGAAAATTAAAAGTAGCTCATGTCAACTATGGTTCTGATTTTACAATTGACGTA
    GCTAATAAAGTTTTTGAATTGAATATTCAAAATCCAAATGTTGATGAGCATTAA
    60
    120
    180
    234

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS06075 [old locus tag: NWMN_1072 ]
  • symbol: NWMN_RS06075
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 4.03259
  • theoretical MW: 8898.84
  • GRAVY: -0.0519481

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined DUF4860; Domain of unknown function (DUF4860) (PF16152; HMM-score: 13.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00253
    • TAT(Tat/SPI): 0.000094
    • LIPO(Sec/SPII): 0.000516
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MVFNDWEINVVYSGEHEVVTNEKSLFVIDEFYDVAIAIYYLDGKLKVAHVNYGSDFTIDVANKVFELNIQNPNVDEH

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]