From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1106 [new locus tag: NWMN_RS06255 ]
  • pan locus tag?: SAUPAN003472000
  • symbol: NWMN_1106
  • pan gene symbol?: —
  • synonym:
  • product: putative transposase

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1106 [new locus tag: NWMN_RS06255 ]
  • symbol: NWMN_1106
  • product: putative transposase
  • replicon: chromosome
  • strand: -
  • coordinates: 1210988..1211197
  • length: 210
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGAGTTTCACTCGAATGTCAGTTCGAGGAATAAATAAAGTTAAACGAGAGCTAGGTTTT
    GTATTAATGGCAATTAATATAAGGAAAATAGCAGCTCAACGAGCTGTACATTATAAAATA
    CATATCAAAAAAGCTGATTTCTATCAAATAATTAATAGAAATCAGCTTTTTACATTGCCT
    AAGAACTTAATGTCCCAGCCTCCTTCATAA
    60
    120
    180
    210

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_1106 [new locus tag: NWMN_RS06255 ]
  • symbol: NWMN_1106
  • description: putative transposase
  • length: 69
  • theoretical pI: 11.9997
  • theoretical MW: 8072.64
  • GRAVY: -0.17971

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for N315, NCTC8325
  • PFAM:
    RNase_H (CL0219) DDE_Tnp_1_6; Transposase DDE domain (PF13751; HMM-score: 16.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.5
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.02206
    • TAT(Tat/SPI): 0.005798
    • LIPO(Sec/SPII): 0.002596
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSFTRMSVRGINKVKRELGFVLMAINIRKIAAQRAVHYKIHIKKADFYQIINRNQLFTLPKNLMSQPPS

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=NWMN_1106&oldid=63051"