Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1038 [new locus tag: SA_RS05905 ]
- pan locus tag?: SAUPAN003472000
- symbol: tnp
- pan gene symbol?: —
- synonym:
- product: transposase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1038 [new locus tag: SA_RS05905 ]
- symbol: tnp
- product: transposase
- replicon: chromosome
- strand: -
- coordinates: 1175212..1175424
- length: 213
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123869 NCBI
- RefSeq: NP_374311 NCBI
- BioCyc: see SA_RS05905
- MicrobesOnline: 103337 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATTTTGAGTTTCACTCGAATGTCAGTTCGAGGAATAAATAAAGTTAAACGAGAGCTAGGT
TTTGTATTAATGGCACTTAATATAAGGAAAATAGCAGCTCAACGAGCTGTACATTATAAA
ATACATATCAAAAAAGCTGATTTCTATCAAATAATTAATAGAAATCAGCTTTTTACATTG
CCTAAGAACTTAATGTCCCAGCCTCCTTCATAA60
120
180
213
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1038 [new locus tag: SA_RS05905 ]
- symbol: Tnp
- description: transposase
- length: 70
- theoretical pI: 11.9997
- theoretical MW: 8185.8
- GRAVY: -0.132857
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Mobile element protein
- PFAM: RNase_H (CL0219) DDE_Tnp_1_6; Transposase DDE domain (PF13751; HMM-score: 17)and 1 moreno clan defined Relaxase_M; Relaxase central domain (PF20874; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8587
- Cytoplasmic Membrane Score: 0.0113
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.1295
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.5
- Signal peptide possibility: 0
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.027553
- TAT(Tat/SPI): 0.007985
- LIPO(Sec/SPII): 0.002696
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLSFTRMSVRGINKVKRELGFVLMALNIRKIAAQRAVHYKIHIKKADFYQIINRNQLFTLPKNLMSQPPS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]