From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1252 [new locus tag: NWMN_RS07070 ]
  • pan locus tag?: SAUPAN003715000
  • symbol: NWMN_1252
  • pan gene symbol?: sosA
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1252 [new locus tag: NWMN_RS07070 ]
  • symbol: NWMN_1252
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1375780..1376013
  • length: 234
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTTTTACAATAAATATAAAAACGTATCAACATATATCATCATATTTTTAGTTTCAAGT
    GCAGCCTTTGCAATATTCTTGTTAAGTGCGAACATTAGTGCTCACTCGGAACAAGTGTAC
    GAAATGACTGACCATCAAATTAAGAACAATACGATAAATAAAGCATACGAACATAAAGAC
    CCTACAAACAATAGCGAACAAAGAGATGGGAAAGTGTTCGCTTTAATAAATTGA
    60
    120
    180
    234


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_1252 [new locus tag: NWMN_RS07070 ]
  • symbol: NWMN_1252
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 7.76467
  • theoretical MW: 8861.94
  • GRAVY: -0.292208

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01107901: hypothetical protein
  • PFAM:
    no clan defined PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 15.4)
    Trigger_C (CL0262) SurA_N_3; SurA-like N-terminal domain (PF13624; HMM-score: 13.2)
    and 1 more
    no clan defined DUF3674; RNA dependent RNA polymerase (PF12426; HMM-score: 12)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.0745
    • Cell wall & surface Score: 0.0022
    • Extracellular Score: 0.9232
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: AIFLLSAN
  • SignalP: Signal peptide SP(Sec/SPI) length 36 aa
    • SP(Sec/SPI): 0.949776
    • TAT(Tat/SPI): 0.004907
    • LIPO(Sec/SPII): 0.027163
    • Cleavage Site: CS pos: 36-37. AHS-EQ. Pr: 0.6614
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANISAHSEQVYEMTDHQIKNNTINKAYEHKDPTNNSEQRDGKVFALIN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • data available for JSNZ

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]