From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1375 [new locus tag: SACOL_RS07000 ]
  • pan locus tag?: SAUPAN003715000
  • symbol: SACOL1375
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1375 [new locus tag: SACOL_RS07000 ]
  • symbol: SACOL1375
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1379598..1379831
  • length: 234
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTTTTACAATAAATATAAAAACGTATCAACATATATCATCATATTTTTAGTTTCAAGT
    GCAGCCTTTGCAATATTCTTGTTAAGTGCGAACATTAGTGCTCACTCGGAACAAGTGTAC
    GAAATGACTGACCATCAAATTAAGAACAATACGATAAATAAAGCATACGAACATAAAGAC
    CCTACAAACAATAGCGAACAAAGAGATGGGAAAGTGTTCGCTTTAATAAATTGA
    60
    120
    180
    234

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1375 [new locus tag: SACOL_RS07000 ]
  • symbol: SACOL1375
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 7.76467
  • theoretical MW: 8861.94
  • GRAVY: -0.292208

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01107901: hypothetical protein
  • PFAM:
    Trigger_C (CL0262) SurA_N_3; SurA N-terminal domain (PF13624; HMM-score: 13.6)
    no clan defined DUF3674; RNA dependent RNA polymerase (PF12426; HMM-score: 12)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: AIFLLSAN
  • SignalP: Signal peptide SP(Sec/SPI) length 36 aa
    • SP(Sec/SPI): 0.949776
    • TAT(Tat/SPI): 0.004907
    • LIPO(Sec/SPII): 0.027163
    • Cleavage Site: CS pos: 36-37. AHS-EQ. Pr: 0.6614
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANISAHSEQVYEMTDHQIKNNTINKAYEHKDPTNNSEQRDGKVFALIN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: Signal peptide containing [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]