Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001324 [new locus tag: EGJ38_RS06610 ]
- pan locus tag?: SAUPAN003715000
- symbol: sosA
- pan gene symbol?: sosA
- synonym:
- alternate name: JSNZ_001324
- product: DNA damage-induced cell division inhibitor SosA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001324 [new locus tag: EGJ38_RS06610 ]
- symbol: sosA
- product: DNA damage-induced cell division inhibitor SosA
- replicon: chromosome
- strand: +
- coordinates: 1331630..1331863
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423288 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTTTACAATAAATATAAAAACGTATCAACATATATCATCATATTTTTAGTTTCAAGT
GCAGCCTTTGCAATATTCTTGTTAAGTGCGAACGTTAGTGCTCACTCGGAACAAGTGTAC
GAAATGACTGACCATCAAATTAAGAACAATACGATAAATAAAGCATACGAACATAAAGAC
CCTACAAACAATGGCGAACAAAGAGATGGGAAAGTGTTCGCTTTAATAAATTGA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001324 [new locus tag: EGJ38_RS06610 ]
- symbol: SosA
- description: DNA damage-induced cell division inhibitor SosA
- length: 77
- theoretical pI: 7.76467
- theoretical MW: 8817.88
- GRAVY: -0.290909
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 9.87
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.0242
- Cell wall & surface Score: 0.0029
- Extracellular Score: 0.9729
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 36 aa
- SP(Sec/SPI): 0.965373
- TAT(Tat/SPI): 0.004489
- LIPO(Sec/SPII): 0.022725
- Cleavage Site: CS pos: 36-37. AHS-EQ. Pr: 0.4835
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423288 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANVSAHSEQVYEMTDHQIKNNTINKAYEHKDPTNNGEQRDGKVFALIN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)