Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1175 [new locus tag: SA_RS06680 ]
- pan locus tag?: SAUPAN003715000
- symbol: SA1175
- pan gene symbol?: sosA
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1175 [new locus tag: SA_RS06680 ]
- symbol: SA1175
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1337897..1338130
- length: 234
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124012 NCBI
- RefSeq: NP_374454 NCBI
- BioCyc: see SA_RS06680
- MicrobesOnline: 103480 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTTTACAATAAATATAAAAACGTATCAACATATATCATCATATTTTTAGTTTCAAGT
GCAGCCTTTGCAATATTCTTGTTAAGTGCGAACGTTAGTGCTCACTCGGAACAAGTGTAC
GAAATGACTGACCATCAAATTAAGAACAATACGATAAATAAAGCATACGAACATAAAGAC
CCTACAAACAATGGCGAACAAAGAGATGGGAAAGTGTTCGCTTTAATAAATTGA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1175 [new locus tag: SA_RS06680 ]
- symbol: SA1175
- description: hypothetical protein
- length: 77
- theoretical pI: 7.76467
- theoretical MW: 8817.88
- GRAVY: -0.290909
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01107901: hypothetical protein
- PFAM: no clan defined PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 15)Trigger_C (CL0262) SurA_N_3; SurA-like N-terminal domain (PF13624; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 9.87
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.0242
- Cell wall & surface Score: 0.0029
- Extracellular Score: 0.9729
- LocateP: Secretory(released) (with CS)
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: ANVSAHSE
- SignalP: Signal peptide SP(Sec/SPI) length 36 aa
- SP(Sec/SPI): 0.965373
- TAT(Tat/SPI): 0.004489
- LIPO(Sec/SPII): 0.022725
- Cleavage Site: CS pos: 36-37. AHS-EQ. Pr: 0.4835
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFYNKYKNVSTYIIIFLVSSAAFAIFLLSANVSAHSEQVYEMTDHQIKNNTINKAYEHKDPTNNGEQRDGKVFALIN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]